KEGG   Acidovorax avenae: Acav_3203Help
Entry
Acav_3203         CDS       T01445                                 

Definition
(GenBank) L-lactate dehydrogenase (cytochrome)
  KO
K00101  L-lactate dehydrogenase (cytochrome) [EC:1.1.2.3]
Organism
aaa  Acidovorax avenae
Pathway
aaa00620  Pyruvate metabolism
aaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acav_3203
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.3  L-lactate dehydrogenase (cytochrome)
     Acav_3203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_dh NMO IMPDH Glu_synthase His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADX47105
JGI: Acav_3203
UniProt: F0Q8A7
Position
complement(3643987..3645147)
Genome map
AA seq 386 aa AA seqDB search
MSPLSRITCIEDLRTVARRRVPRMFYDYADSGSYTESTYRANSEDFQKIRLRQRVAVNME
NRTTRTTMVGQEVAMPVAIAPTGLTGMQHADGEILGARAARAFGVPFTLSTMSICSIEDV
AEHAGPGFWFQVYVMRDRDFVERLIDRAKAAGVSALQVTLDLQILGQRHKDIKNGLSTPP
RPTLANLLDLATKPRWCAGMLGTKRRSFGNIVGHAKGVGDLSSLSSWTAEQFDPRLNWRD
IEWIKKRWGGKLILKGIMDADDARLAVETGADAIVVSNHGGRQLDGAPSSIHALPPIVDA
VGRDIEVWMDGGVRGGQDVLKAWALGARGTLIGRSFLYGLGAFGEAGVTRALQIIQKELD
ITMAFCGHTDIHQVDRSILLPGTLPG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgtccccactgtcccgcatcacctgcatcgaagacctgcgcaccgtcgcccgccggcgc
gtaccgcgcatgttctacgactacgccgattccggctcctatacggaaagcacctaccgc
gccaattccgaggacttccagaagatcaggctgcgccagcgcgtggccgtgaacatggag
aaccgcaccacccgcacgacgatggtgggccaggaagtggccatgccggtggcgatcgcg
cccacggggctgaccggcatgcagcatgcggacggtgaaatcctcggcgcacgcgcggcg
cgggccttcggcgtgccgttcacgctgtccacgatgagcatctgctccatcgaggatgtg
gccgaacacgccgggccgggcttctggttccaggtctatgtgatgcgcgaccgtgatttc
gtcgaacgcctcatcgaccgcgccaaggcagccggcgtgtcggcgctgcaggtcacgctg
gacctgcagatcctcggacaacgccacaaggacatcaagaacgggctgtccacgccgccg
cggcccacgctggccaacctgctcgacctggcgaccaagccgcgctggtgcgccggcatg
ctgggtacgaagcggcgcagcttcggcaacatcgtgggccacgccaagggggtgggcgat
ctttcgtcgctgtcgtcgtggacggccgagcagttcgatccccggctcaactggcgcgac
atcgagtggatcaagaaacgctggggcggcaagctcatcctcaagggcatcatggatgcg
gacgacgcgcggctcgcggtggagacgggcgcggacgccatcgtggtgagcaaccatggc
ggacggcagctcgacggtgcgccatcgtccatccatgcgctgccacccatcgtcgatgcg
gtgggccgtgacatagaggtatggatggacggcggcgtccgcggcggccaggacgtgctc
aaggcctgggcactcggagcccggggcacgctcatcgggcgcagcttcctgtacggtctt
ggtgccttcggggaggctggcgtcacccgggccctgcagatcatccagaaagagctggac
atcacgatggccttctgcggccataccgacatccaccaagtggatcgctccatcctgctg
ccgggcacgctgcccggctga

DBGET integrated database retrieval system