KEGG   Acidovorax avenae: Acav_3461Help
Entry
Acav_3461         CDS       T01445                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
aaa  Acidovorax avenae
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Acav_3461
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Acav_3461
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Acav_3461
Two-component system [BR:aaa02022]
 CheA family
  CheA-CheYBV
   Acav_3461
Bacterial motility proteins [BR:aaa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Acav_3461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3930021..3931094
Genome map
AA seq 357 aa AA seqDB search
MKPIQVIVVDDSAVVRQVLTGLLGEAPGIEVLHAAADPLLAMERMKHQWPDVILLDVEMP
RMDGITFLRKIMAERPTPVVICSTLTEKGARTTMEALAAGAVAIVTKPRLGLKSFLTESA
DELVATVRAAARANVRRLARQPAAPAMAPPPGKNTADAILPPGAGRAMAQTTERVVAIGT
STGGTQALEEVLTALPRVCPGIVIVQHMPEKFTAAFASRLDGLCRIAVKEAENNDRVVPG
RALIAPGGKHMLLRRSGAQYHVEVLDGPLVNRHRPSVDVLFRSVAKCAGANAHGIIMTGM
GDDGAAGLLEMHQAGARTTAQDEESCVVFGMPKEAIKRGGVDKVLPLSAIWREIGGA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatccaagtcatcgtcgtggacgattccgccgtcgtgcgccaggtactcacc
ggcctgctcggggaggcgcccggcatcgaggtgctgcatgcggcagccgacccgctgctg
gccatggagcgcatgaagcaccagtggccggacgtgatcctgctggatgtcgagatgccc
cgcatggacggcatcaccttcctgcgcaagatcatggccgagcgccccacgcccgtcgtc
atctgctccaccctcacggaaaaaggcgccaggaccaccatggaggcgctcgccgccggc
gcggtggccatcgtgaccaagccccggctgggcctcaagagcttcctgaccgagagcgcg
gacgaactggtcgccaccgtgcgcgccgcggcgcgcgccaacgtgcggcgcctggcccgg
cagcctgcagcgcccgcgatggcgcccccgcccggcaaaaacaccgccgacgccatcctg
ccgcccggtgcgggccgcgcgatggcccagaccaccgagcgcgtggtggccatcggcacc
tccaccggcggcacgcaggctctggaagaggtgctcaccgccctgccccgcgtatgcccc
ggcatcgtcatcgtgcagcacatgccggaaaaattcaccgctgccttcgccagccgcctg
gacggcctgtgccgcatcgccgtcaaggaggcggaaaacaacgaccgcgtcgtccccggc
cgcgcactgatcgccccgggaggcaagcacatgctgctgcggcgcagcggtgcccagtac
cacgtggaagtgctcgacggccccctggtgaaccgccaccgcccctccgtggacgtgctg
ttccgctccgtggccaaatgcgcgggcgccaacgcccacggcatcatcatgaccggcatg
ggcgacgacggcgccgccggcctgctcgagatgcaccaggccggcgcccgcacgaccgcc
caggacgaagagagctgcgtcgtcttcggcatgccgaaggaggcgatcaagcgggggggc
gtggacaaggtgctgccgctgtcggcgatctggcgggagatcgggggggcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system