KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_3500Help
Entry
Acav_3500         CDS       T01445                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3967437..3968126)
Genome map
AA seq 229 aa AA seqDB search
MTMVTSGRGIALIEEFEGFRAQAYRDPVGIWTIGYGFTRGVRAGDTMTREQADARLRQEL
GEYEAGVARATGGRATQAQFDALVSFAFNVGVEGMAASSVLRAHNRGDHEAAARAFALWN
KAGGKTWPGLTRRRAAEAALYLGDAPAGMPRAVEPERTMAESTINRAGVAAGSTAAVAAI
AETARAVSDIKASADSLGDWLQPLLMVAVVALCSYIVRERIRVRREGWS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggtgacttccgggcgcggcatcgcgctgatcgaggagttcgagggtttccgc
gcccaggcgtaccgcgatcccgtgggcatctggaccatcggctacggtttcacgcgcggc
gtgcgtgccggggacacgatgacgcgcgagcaggccgatgcccgcctgcgccaggagctg
ggcgagtacgaggcgggcgtggcgcgggccacgggcggccgggccacgcaggcgcagttc
gatgcgctggtgtctttcgcgttcaacgtgggcgtcgagggcatggccgcttccagcgtc
ctgcgggcgcacaaccgtggcgaccacgaagctgctgcgcgggcattcgccctgtggaac
aaggccggaggcaagacgtggcccgggttgacccggcgccgtgccgcagaggctgcgctg
tacctgggcgatgcgcctgccggcatgccccgggccgtcgagcccgagcgcaccatggca
gagagcacgatcaaccgcgcaggcgtcgccgcaggcagcactgcggcggtggccgccatc
gccgagacggcgcgggcggtcagcgacatcaaggccagcgcggacagcctgggtgactgg
ctgcagccgttgctgatggtggccgtggtggcgctgtgctcctatatcgtccgtgagcgg
atccgtgtacggcgggagggctggtcatga

DBGET integrated database retrieval system