KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_3524Help
Entry
Acav_3524         CDS       T01445                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:aaa00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3993372..3994229
Genome map
AA seq 285 aa AA seqDB search
MRALHDLPAPAKLNLFLHITGRRPDGYHLLQSAFMLIDWCDTLHFELRADGGISREDTGA
GLPADDLCTRAARALQEATGTRQGAHIILEKSIPAQAGMGGGSSDAATTLLALNRLWGLG
LGRVSLERIGLSLGADIPFFLRGRNAWVEGIGETITPLENVHALPESRFVVVKPEAGLDT
KSIFSSPSLERNSERATISGFAAAHYQFGKNVLQPVAELLCPEVSEAIRWLEHKGLQARM
TGSGSAVFAQMTHAIDLFDLPTGWRAKVCDNLRLHPLAGWAADED
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctccacgacctgcccgccccggcaaagctcaacctgttcctgcacatcacc
gggcgcaggcctgacggctaccacctgctgcagtcggccttcatgctgatcgactggtgc
gacacgctgcatttcgaactgcgcgcggacggcgggatcagccgggaagacacgggtgcc
gggctgcctgccgacgacctctgcacccgcgcggcgcgggcgctgcaggaggccacgggc
acgcggcagggcgcgcacatcatcctggagaagtccatccccgcgcaggccggcatgggt
ggcggctcctctgacgcggcgaccacgctgctcgccctcaaccggctctggggcctgggc
ctgggccgcgtgtcgctcgagcgcatcggcctgtcgctcggcgccgacattcccttcttt
ttgcgcggcaggaacgcctgggtcgagggaatcggtgagacaatcacgccgctcgagaac
gtgcacgcgctgccggagagccggttcgtggtggtcaagcccgaagccggactggatacg
aaatcgattttttcgtctccttcgctggaacgcaattcagagcgtgctacaatctcaggc
tttgctgcagcacactaccaatttggtaaaaacgttctgcagccggtcgcagaactgctc
tgccccgaggtctccgaagccatccgctggctggagcacaagggattgcaggcgaggatg
accggctcgggaagtgcggtgtttgcgcaaatgacacatgcgatcgatttattcgatctg
cccaccggatggagggcaaaagtatgtgataatctgaggctccaccccctcgcagggtgg
gcagcagatgaagattga

DBGET integrated database retrieval system