KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_3548Help
Entry
Acav_3548         CDS       T01445                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aaa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4017306..4018031)
Genome map
AA seq 241 aa AA seqDB search
MFTHLADDPDSAPPPEGAPVSAKIRERLLAARKRFHANDNIADFLEPGELEQLLDEVEAK
MQGVLDSMVIDTAGDHNTQDTARRVAKMYLGEVFRGRYVKQPAITEFPNAEHLNELMIVG
PITVRSACSHHFCPVIGKLWIGVLPNEHTNVIGLSKYARLVDWVMGRPQIQEEAVVQLAD
LIMEKTQPDGLAIVMEASHFCMSWRGVREMDSKMLNSVMRGVFLKDAALRREFLSLIPGR
T
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgttcacacacctcgccgacgatccggacagcgcgcccccgcccgaaggcgcgcctgtc
tcggccaagatccgtgagcgcctgctcgcggcccgcaagcggttccatgccaatgacaac
atcgccgacttcctggagcccggcgaactcgagcaattgctcgacgaggtcgaggccaag
atgcagggcgtgctcgacagcatggtcatcgacacggccggcgaccacaacacccaggac
accgcccggcgcgtggcgaagatgtacctgggcgaggtgttccggggccgttacgtcaag
cagcccgcgatcaccgaattccccaatgccgagcacctgaacgagctcatgatcgtcggg
ccgatcaccgtgcgcagcgcctgcagccaccatttctgccccgtgatcggcaagctgtgg
atcggcgtgctgcccaacgagcacacgaacgtcatcggcctgtcgaagtacgcgcgcctg
gtggactgggtcatggggcgcccgcagatccaggaggaggccgtggtgcagctggccgac
ctcatcatggaaaagacccagcccgacggcctcgcgatcgtgatggaggccagccacttc
tgcatgtcctggcggggcgtgcgcgagatggacagcaaaatgctgaactcggtgatgcgc
ggcgtcttcctgaaggacgctgcgctgcgccgggaattcctctcgctcatccccggaagg
acctga

DBGET integrated database retrieval system