KEGG   Acidovorax avenae: Acav_3658Help
Entry
Acav_3658         CDS       T01445                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
aaa  Acidovorax avenae
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Acav_3658
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Acav_3658
Enzymes [BR:aaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Acav_3658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4163478..4164260
Genome map
AA seq 260 aa AA seqDB search
MQLKDKVAFITGSASGIGKEIATLFAKEGAKVVIADLNKDAATATADELKATGAQALGVA
VDVTDEAQVDAAVEEAARAFGGIDILVSNAGIQIVQPVEEFSFADWKKMLAIHLDGAFLT
TRACLKHMYAQGRGGSVIYMGSVHSKEASKLKAPYVTAKHGLIGLCKTVAKEGAAKGVRA
NVICPGFVRTPLVEKQIPEQARTLGITEEEVVKNVMLKETVDGEFTTTDDVARAALLFAA
FPTNALTGQSLVVSHGWFMQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcaaggacaaggtcgctttcatcaccggctcggccagcggcatcggcaaggaa
atcgccaccctcttcgcgaaggaaggcgcgaaggtcgtcatcgccgacctgaacaaggac
gccgccaccgccacggcggacgagctcaaggccaccggcgcccaggccctgggcgtggcc
gtcgatgtgacggacgaggcccaggtggacgccgccgtcgaggaggccgccagggccttc
ggcggcatcgacatcctggtgagcaacgccggcatccagatcgtgcaaccggtggaggaa
ttcagcttcgccgactggaagaagatgctcgccatccacctggacggcgccttcctcacc
acgcgcgcctgcttgaagcacatgtacgcccagggccgcggcggcagcgtgatctacatg
ggctcggtgcactccaaggaagcctccaagctcaaggccccctacgtgacggccaagcac
ggcctgatcggcctgtgcaagacggtcgccaaggagggcgccgccaagggcgtgcgcgcc
aacgtgatctgccccggcttcgtgcgcacgcccctggtggaaaagcagatccccgagcag
gccaggaccctgggcatcaccgaagaggaagtggtgaagaacgtcatgctcaaggaaacg
gtggacggcgaattcaccaccaccgacgacgtggcgcgcgccgccctgctgttcgccgcc
ttccccacgaatgcgctcaccggccagtcgctggtggtgagccacggctggttcatgcag
tga

DBGET integrated database retrieval system