KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_3766Help
Entry
Acav_3766         CDS       T01445                                 

Definition
phosphoglycerate mutase family protein (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:aaa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aaa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aaa00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:aaa00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aaa00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4296815..4297558
Genome map
AA seq 247 aa AA seqDB search
MHKLVLIRHGESTWNLENRFTGWTDVDLTPTGIEQAKTAGRLLKAEGYEFDLAFTSVLKR
ATRTLWHVLDEMDRTWLPVEHSWRLNERHYGALQGLNKADMAKQYGDAQVLVWRRSYDTP
PPALEATDPRSERGDIRYAGLDAEQIPLTECLKDTVARVLPFWNERIAPAMRSGQRVMVA
AHGNSIRALVKYLDGISDDDIVGLNIPNGIPLVYELGDDLKPLRHYYLGDAEAAAQAAAA
VASQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaactcgtcctgatccgccacggcgaatccacctggaacctcgaaaaccgcttc
accggctggaccgacgtggacctgactcccaccggcatcgagcaggccaagaccgccggc
cgcctcctgaaggccgaaggctacgagttcgacctggccttcaccagcgtgctcaagcgc
gccacgcgcaccctgtggcatgtcctggacgagatggaccgcacctggctgcccgtggag
cacagctggcgcctcaacgagcgccactacggcgccctgcaggggctcaacaaggccgac
atggccaagcagtacggcgatgcgcaggtgctcgtctggcgccgcagctacgacacaccc
ccgccggccctggaggccaccgatccgcgcagcgagcgcggcgacatccgttacgcgggc
ctcgatgccgagcagatcccgctcaccgaatgcctgaaggacaccgtcgcccgcgtcctg
cccttctggaacgagcgcatcgcgcctgccatgcgatcgggccagcgcgtaatggtcgcc
gcccacggcaactcgatccgtgcgctggtcaagtacctggacggcatctccgacgacgac
atcgtcgggctgaacattcccaacggcattcccctggtctacgaactgggcgacgacctg
aagccgctgcgccattactacctgggcgatgccgaggccgcggcccaggcggccgccgcg
gtcgcgtcccagggcaaggcctga

DBGET integrated database retrieval system