KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_3897Help
Entry
Acav_3897         CDS       T01445                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:aaa02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:aaa02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4457047..4457658)
Genome map
AA seq 203 aa AA seqDB search
MIRPTAAPQVPARPFEAIVIGGSAGSIEALSVLLPALGPAQRAAVFVVLHLPRDRRSLLC
EIFQPRCALPLREAQDKEPVEAGTVYFAPPDYHLLIDAGPSLALSVDDPVHFSRPSIDVL
FESAADAYAGRLLAILLSGANHDGAQGIAAVQAAGGTTIVQDPESAPMSSMPEAALQLCT
PAHVLSPQRIADWLAALPPGGRA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtcccaccgccgccccgcaggtgcctgcccggccgttcgaggcgatcgtcatc
ggcggctccgccggcagcatcgaggcgctgtccgtgctgctgcccgcgctcgggcccgcg
cagcgcgccgcggtattcgtggtgctgcacctgccgcgcgaccggcgcagcctgctgtgc
gagatcttccagccgcgctgcgcactgccgctgcgcgaggcgcaggacaaggagccggtg
gaagcgggcaccgtctatttcgcgccgcccgactaccacctgctcatcgacgccgggccg
tcgctggccctgtcggtcgatgatcccgtgcacttctcgcgcccgtccatcgacgttctt
ttcgagtccgccgcggacgcctatgccgggcggctgctggccatcctgctctccggcgcc
aaccacgacggggcccagggcatcgcggccgtgcaggccgcgggcggcacgaccatcgtg
caagatcccgaaagcgctcccatgagttccatgcccgaagcggcgctgcagctgtgtacg
ccggcccatgtcctttcgccgcagcgcatcgccgactggctggccgcactgccgccagga
gggcgcgcatga

DBGET integrated database retrieval system