KEGG   Acidovorax avenae: Acav_4071Help
Entry
Acav_4071         CDS       T01445                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aaa  Acidovorax avenae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Acav_4071
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Acav_4071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4654891..4655871
Genome map
AA seq 326 aa AA seqDB search
MTASSRPAPEIPSRSAPPRIAVVGSLNMDIVLRVPRAPGAGETVMADSLHHIPGGKGGNQ
AVACARQGAHVHLLGRVGHDAHGAALRAALDADAIDHAGVQTDAEAPTGIACITVESTAQ
NRIVVVGGANARFEIDAQALGAALQGASSLLLQFEVPMPQVMAAARQAHQRGCPVVLNPS
PMQPIPDALWPLVDTLVANEVEAALFADCDVETPEDAAHAARLLRARGPRQVVVTLGAAG
AVACDGNGCRHHLGLRVDAVDTTAAGDTFLGALTVALARGESLDLAVQTGVRAAALCVTR
PGAQPSIPTRAEVAASPLPPEWSRIA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcttcccgccccgccccggagatcccttcccgttccgccccgccgcgcatc
gccgtggtgggcagcctcaacatggacatcgtcctgcgcgtgccccgggcccccggcgca
ggcgagaccgtgatggccgattcactgcaccacattccgggaggcaaggggggcaaccag
gcagtggcctgtgcgcgccagggagcccatgtgcacctgctgggccgcgtcggtcacgat
gcgcacggagcggccctgcgcgccgcgctggatgccgacgctatcgaccatgccggcgtg
cagacggacgccgaggcccctacgggcatcgcctgcatcacggtggaatccaccgcgcag
aaccgtatcgtcgtcgtcggcggggcgaacgcccgcttcgagatcgacgcgcaggccctg
ggcgcggcgctgcagggagccagcagcctgctgctgcagttcgaagtgccgatgccgcag
gtgatggccgccgccaggcaggcgcaccagcggggctgtcccgtggtgctcaacccgtcg
cccatgcagccgatccccgatgccctctggccgctggtggacaccctggtggccaacgag
gtggaagccgcgctgttcgccgactgcgacgtggaaacacccgaagatgctgcccatgcc
gcacgcctgctgcgggcacggggcccgcggcaggtggtggtgacgctgggcgcggcgggc
gccgtggcctgcgacggcaacggctgccggcaccacctgggcctgcgcgtggatgccgtg
gacaccacggccgcgggcgacaccttcctgggcgccctgaccgtcgcgctggcacgcggc
gaatcgctcgacctggcggtgcagaccggcgtccgcgccgcggcgctgtgcgtgacccgc
ccgggcgcgcagccatcgatccccacgcgcgccgaagtggccgcatcccccctgccccct
gaatggagccgcatcgcatga

DBGET integrated database retrieval system