KEGG   Acidovorax avenae: Acav_4086Help
Entry
Acav_4086         CDS       T01445                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
aaa  Acidovorax avenae
Pathway
aaa00010  Glycolysis / Gluconeogenesis
aaa00052  Galactose metabolism
aaa00500  Starch and sucrose metabolism
aaa00520  Amino sugar and nucleotide sugar metabolism
aaa00521  Streptomycin biosynthesis
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01120  Microbial metabolism in diverse environments
aaa01130  Biosynthesis of antibiotics
aaa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acav_4086
   00052 Galactose metabolism
    Acav_4086
   00500 Starch and sucrose metabolism
    Acav_4086
   00520 Amino sugar and nucleotide sugar metabolism
    Acav_4086
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Acav_4086
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Acav_4086
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Acav_4086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Rick_17kDa_Anti
Motif
Other DBs
NCBI-ProteinID: ADX47976
JGI: Acav_4086
UniProt: F0Q520
Position
complement(4670239..4671174)
Genome map
AA seq 311 aa AA seqDB search
MRACIDIGGTKVAVALAPAGTDRATLVARRTEPTVKEGPPDALARQCLRMVDEACAEAGI
SRAQLQSTGVASCGPFVLQDGMVEVSTPNICGGLPGADRSLLPNDWTRIPLQAPLAEVLQ
NVNVQNDAVAALVAERRWGALQGLDHCAYVTWSTGVGVGLCVDGIVLRGKNGNAGHAGHS
FSSDGPQDATCGCGNVADVESLVAGNAIPRRWGRDAGGLIGAAREGDAAAAEAVSQMCRV
LGRMLYNLVAILDLQRISIGGSVFLHHQDFLLPRLQAEVSGHLPALTGGVLVVPAGLGHQ
IGDYAALAMAG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttgtatcgacatagggggaacgaaggtcgcggtggcgctggcgcccgcggga
acggaccgggcaacgctcgtggcgcgccgcaccgagccgaccgtgaaggaggggccgccc
gacgcgctggcgcgccagtgcctgcgcatggtggacgaggcctgtgccgaggccggcata
tcgcgcgcgcagctgcagtccaccggcgtggcgagctgcgggcccttcgtcctgcaggac
ggcatggtcgaggtctccacccccaacatctgcggcggcctgccgggcgccgaccgcagc
ctgctgcccaacgactggacgcgcatcccgctgcaggccccgctggccgaggtgctgcag
aacgtgaacgtgcagaacgatgcggtggccgcgctcgtggccgagcgccgctggggcgca
ctgcaggggctggaccactgcgcttatgtcacctggagcacgggtgtcggcgtgggcctg
tgcgtggatggcatcgtgctgcgcggcaagaacggcaatgcgggccacgcggggcacagc
ttttccagcgatggcccgcaggacgcaacctgcggctgcggtaacgtggccgacgtggaa
tcgctggtcgcgggcaacgcgattccccggcgctggggccgcgatgcgggtggcctgatc
ggcgccgcgcgcgaaggcgatgccgccgccgccgaggccgtgtcgcagatgtgccgcgtg
ctcggccgcatgctctacaacctcgtcgccatcctggacctgcagcgcatcagcatcggc
gggagcgtgttcctgcaccaccaggatttcctgctgccccggctgcaggccgaagtgtcg
ggacacctgcccgcgctcacgggcggcgtgctggtggtgccggccggactggggcaccag
atcggggattacgcggcgctcgccatggccggctga

DBGET integrated database retrieval system