KEGG   Acidovorax avenae: Acav_4086Help
Entry
Acav_4086         CDS       T01445                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aaa  Acidovorax avenae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acav_4086
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acav_4086
   00052 Galactose metabolism
    Acav_4086
   00500 Starch and sucrose metabolism
    Acav_4086
   00520 Amino sugar and nucleotide sugar metabolism
    Acav_4086
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Acav_4086
   00524 Butirosin and neomycin biosynthesis
    Acav_4086
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Acav_4086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4670239..4671174)
Genome map
AA seq 311 aa AA seqDB search
MRACIDIGGTKVAVALAPAGTDRATLVARRTEPTVKEGPPDALARQCLRMVDEACAEAGI
SRAQLQSTGVASCGPFVLQDGMVEVSTPNICGGLPGADRSLLPNDWTRIPLQAPLAEVLQ
NVNVQNDAVAALVAERRWGALQGLDHCAYVTWSTGVGVGLCVDGIVLRGKNGNAGHAGHS
FSSDGPQDATCGCGNVADVESLVAGNAIPRRWGRDAGGLIGAAREGDAAAAEAVSQMCRV
LGRMLYNLVAILDLQRISIGGSVFLHHQDFLLPRLQAEVSGHLPALTGGVLVVPAGLGHQ
IGDYAALAMAG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttgtatcgacatagggggaacgaaggtcgcggtggcgctggcgcccgcggga
acggaccgggcaacgctcgtggcgcgccgcaccgagccgaccgtgaaggaggggccgccc
gacgcgctggcgcgccagtgcctgcgcatggtggacgaggcctgtgccgaggccggcata
tcgcgcgcgcagctgcagtccaccggcgtggcgagctgcgggcccttcgtcctgcaggac
ggcatggtcgaggtctccacccccaacatctgcggcggcctgccgggcgccgaccgcagc
ctgctgcccaacgactggacgcgcatcccgctgcaggccccgctggccgaggtgctgcag
aacgtgaacgtgcagaacgatgcggtggccgcgctcgtggccgagcgccgctggggcgca
ctgcaggggctggaccactgcgcttatgtcacctggagcacgggtgtcggcgtgggcctg
tgcgtggatggcatcgtgctgcgcggcaagaacggcaatgcgggccacgcggggcacagc
ttttccagcgatggcccgcaggacgcaacctgcggctgcggtaacgtggccgacgtggaa
tcgctggtcgcgggcaacgcgattccccggcgctggggccgcgatgcgggtggcctgatc
ggcgccgcgcgcgaaggcgatgccgccgccgccgaggccgtgtcgcagatgtgccgcgtg
ctcggccgcatgctctacaacctcgtcgccatcctggacctgcagcgcatcagcatcggc
gggagcgtgttcctgcaccaccaggatttcctgctgccccggctgcaggccgaagtgtcg
ggacacctgcccgcgctcacgggcggcgtgctggtggtgccggccggactggggcaccag
atcggggattacgcggcgctcgccatggccggctga

DBGET integrated database retrieval system