KEGG   Acidovorax avenae: Acav_4230Help
Entry
Acav_4230         CDS       T01445                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
aaa  Acidovorax avenae
Brite
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Acav_4230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4833325..4834269
Genome map
AA seq 314 aa AA seqDB search
MNAAAATLRAMDDSALARPAAPAALHGTEHEYLLEGHGPLATTGILLIHGLTGTPNEMRL
LAKGLHRAGFTVLAVQLAGHCGTQEDLIATRWQDWVASARRGADRLMQLTGQPVVACGLS
MGALLALALAIERPRQVAGVVALSTTFRYDGWSMPAYTRLAFLLPLFRALGIGRRSVFME
APPYGIKDEALRERVVSQMHSGDSAAAGLPGNPWWSVIELRALSAHVRRNLDAVRAPCLV
MHARNDDIAAAGNAQDIVRGVRHAPVELVLLDDSYHMITIDRDRRTVLARTVAFAEAVAR
QRQQEPRRQEGTAP
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgccgcagcgaccttgcgggccatggacgacagcgccctggcccgccccgcg
gcccccgcggccctgcatggcaccgaacatgaatacctgctggagggccacggaccgctc
gccaccaccgggatcctgctgatccacggcctcaccggtacgcccaacgaaatgcggctg
ctcgccaagggcctgcaccgcgcgggcttcaccgtgctcgcggtgcagctggccggccac
tgcggcacgcaggaagacctgatcgccacgcgctggcaggactgggtggccagcgcccgg
cgcggcgcggaccggctcatgcagctcaccggacaaccggtcgtcgcctgcggcctgtcc
atgggcgcactgctggcgctggccctggccatcgagcggcctcggcaggtggccggcgtg
gtggcgttgtccaccaccttccgctacgacggctggagcatgccggcctatacgcgcctg
gccttcctgctgccgctcttccgggccctcggcatcggccgccgcagcgtcttcatggaa
gcaccgccctacggcatcaaggacgaggccctgcgcgaacgcgtggtgtcgcaaatgcat
tcgggcgacagcgcggcggccggcctgccgggcaacccctggtggtcggtgatcgagctg
cgggcgctttccgcccacgtgcggcgcaacctggacgccgtgcgcgcaccctgcctggtg
atgcacgcccgcaacgacgacattgccgcggcaggcaacgcccaggacatcgtgcgcggc
gtgcgccacgccccggtggagctggtgctgctggacgacagctaccacatgatcaccatc
gaccgcgaccgccgcacggtgctcgcgcgcacggtggccttcgcggaagcggtcgcgcga
cagcggcagcaggagccacggcgccaggaaggcactgcgccatga

DBGET integrated database retrieval system