KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_4603Help
Entry
Acav_4603         CDS       T01445                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aaa00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:aaa00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5275155..5275754
Genome map
AA seq 199 aa AA seqDB search
MPRLTAPLILALAAWAAALPAAAQTPPAAPAGPAPSAAACPAVLRHTMPRLQDEAPQDLC
QYKGQVLLVVNTASYCGFTGQYEGLEALHARYKTQGFAVLGFPSNDFAQETGSNAQIADF
CSNTFGVRFPMFAKSSVKGGGASPLYRELAAQAGEAPRWNFHKYLLDRNGKVVASFGSSV
APDDPKIVRAIEQQVKLLR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcctcactgccccgctgatcctcgcactcgcggcctgggcggcagccttgccg
gcggccgcgcaaaccccgccggccgcgccggcagggcccgccccgtcggccgcggcctgc
cctgccgtcctgcgccacaccatgccgcgcctgcaggacgaagcgccccaggacctgtgc
cagtacaagggccaggtgctgctcgtagtcaacaccgccagttactgcggattcaccggc
cagtacgagggcctggaggcgctgcacgcccgttacaagacgcaaggtttcgcagtgctg
ggttttccgtccaacgatttcgcacaggaaaccggcagcaatgcgcaaattgccgacttc
tgcagcaacaccttcggagtgcgctttcccatgttcgccaagagcagcgtcaaaggcggc
ggcgcatcgcccctctaccgcgaactcgcggcccaggcaggcgaagcgccacgatggaac
ttccacaagtacctgctcgaccggaatggcaaggtcgtggcgagctttggcagttccgtg
gccccggatgacccaaaaatcgtccgggccatcgagcagcaagtgaaactgcttcgttaa

DBGET integrated database retrieval system