KEGG   Acidovorax avenae: Acav_4623Help
Entry
Acav_4623         CDS       T01445                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aaa  Acidovorax avenae
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acav_4623
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Acav_4623
   00640 Propanoate metabolism
    Acav_4623
   00660 C5-Branched dibasic acid metabolism
    Acav_4623
Enzymes [BR:aaa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Acav_4623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5292870..5294030)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKEILRNFGVPVPRGIPAFTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
KVAKSIDDVKKLAGDILGMQLKTHQTGPEGQKVRRLYIEDGADIKNELYVSLVTDRATQK
VALIASSEGGMDIEEVAHSTPDKIVTEMIDPIAGITTEQSKKVAAAIGLTGASVDQAVDI
FAKIYKCYMETDASLVEINPLNCDSKGNLMALDAKFNFDANALFRHPEIVAFRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATPEKVTE
AFKIMLKNPKVEGILVNIFGGIMKCDTIATGVITACKAVNLNVPLVVRMKGTNEELGKKM
LAESGLPIIAADTMAEAATKIVAAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgaataccaaggcaaggaaatcttgcgcaattttggtgtgcccgttccc
cgcggcattcccgcgttcacggtgcaggaagctgtggaagccgcccagaagctcggcggc
cccgtgtgggtggtcaaggcccagatccacgccggtggccgtggcaagggcggcggcgtc
aaggtcgccaagagcatcgacgacgtgaagaagctcgccggcgacatcctgggcatgcag
ctcaagacgcaccagaccggtcccgaaggccagaaggtccgccgcctctacatcgaggac
ggcgccgacatcaagaacgaactctacgtctcgctggtcaccgaccgcgccacgcagaag
gtcgccctgatcgcctccagcgaaggcggcatggacatcgaggaagtggcccactccacg
cccgacaagatcgtcaccgagatgatcgaccccatcgccggcatcaccaccgagcagagc
aagaaggtcgcggccgccatcggcctgacgggcgcctccgttgaccaggccgtggacatc
ttcgcgaagatctacaagtgctacatggaaaccgacgcgtcgctggtggaaatcaatccg
ctgaactgcgactccaagggcaacctgatggccctggacgcgaagttcaacttcgacgcc
aacgccctgttccgccatcctgaaatcgtggcattccgcgatctggacgaagaagatccg
gccgaagtggaagcctccaagttcgacctggcctacatcagcctggacggcaacatcggc
tgcctggtgaacggcgcgggcctggccatggccaccatggacaccatcaagctgttcggc
ggcgagccggccaacttcctggacgtgggcggcggcgccacccccgagaaggtcaccgaa
gccttcaagatcatgctgaagaaccccaaggtcgaaggcatcctggtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtcatcaccgcctgcaaggccgtgaac
ctgaacgtgccgctggtcgtgcgcatgaagggcaccaacgaagagctgggcaagaagatg
ctggccgaatccggcctgcccatcatcgccgcagacaccatggccgaagccgcgacgaag
atcgtcgccgccgtcaagtaa

DBGET integrated database retrieval system