KEGG   Acidovorax avenae: Acav_4749Help
Entry
Acav_4749         CDS       T01445                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
aaa  Acidovorax avenae
Brite
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Acav_4749
Transfer RNA biogenesis [BR:aaa03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Acav_4749
 Prokaryotic Type
    Acav_4749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5436256..5436660
Genome map
AA seq 134 aa AA seqDB search
MLKAIAIRAYTAGIAYALGAAFVLAPLSGEARNAPSPGGTDTIALAELPPQGRATFSLIR
EGGPFPHDKDGSVFGNRERLLPPHKRGYYREYTVRTPGASNRGARRIVCGGPPRTPDACY
YTSDHYASFRKIVE
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggccatcgccatccgggcgtacacggcaggtattgcatacgctctgggtgcc
gcgttcgttctggcccctctctcgggggaagcccggaatgctccgtccccgggcggaacc
gacaccatcgcattggccgaacttcccccgcaaggacgcgccaccttcagtctcatccgc
gaaggcggccccttcccacacgacaaggacggtagcgtctttggcaaccgggaacgcctg
ttgcccccgcacaagcggggctactaccgggaatacaccgtcaggacaccgggagcgagc
aaccgtggtgcacggcggatcgtatgcggcggccctccccgcacgccggacgcctgctac
tacaccagcgaccactacgcgagctttcggaagatcgtggaatga

DBGET integrated database retrieval system