KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0028Help
Entry
Aaci_0028         CDS       T00985                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aaci_0028
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Aaci_0028
Enzymes [BR:aac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Aaci_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
37187..38470
Genome map
AA seq 427 aa AA seqDB search
MTYFKTAAELEQHWKTDPRWKGVERAYTAEDVIRLRGSVHIEHTLAQMGAEKLWRGLHED
GFIRALGALTGNQAVQQVKAGLKAIYVSGWQVAADANLAEHMYPDQSLYPSNSVPSLVRR
INNALLRADQIQTAEGKGDIDWMVPIVADAEAGFGGPLNVFELMKMMIEAGAAGVHFEDQ
LSSEKKCGHMGGKVLIPTSHAVRNLTAARLAADVLGVPTVIVARTDANGAFLITSDVDDR
DARFITGERTPEGFYRFRGGLEAAIARGLAYAPYADMIWCETSEPNIEEAKRFAEAIKAE
FPDKLLAYNCSPSFNWRKKLDPKTIEEFQEIIASFGYKFQFVTLAGFHALNYSMFELAYG
YNQRGMGAYSDLQQQEFAAEARGYTATRHQREVGTGYFDEVAQVVSGGLSSTTALTGSTE
EEQFVEA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacatacttcaaaacggcggcggaactggagcagcattggaagacggatcctcgttgg
aaaggcgtcgagcgcgcctatacggccgaagacgtgattcggctcaggggatcggtgcac
attgaacacacactcgcgcagatgggcgcggagaagctgtggcggggtctccatgaagac
ggcttcattcgcgcgctcggtgccctgaccggcaaccaggccgtgcaacaggtgaaagcg
gggctgaaggccatctacgtcagcggctggcaggtggcggcggacgccaacctggctgag
catatgtacccggatcagagcctgtatccgtccaacagcgtgccgagcctcgtgcggcgc
atcaacaacgcgctgttgcgcgcggatcagattcagaccgcggaaggcaagggcgacatc
gactggatggtgccgattgtggccgacgccgaggcaggcttcggcgggccgctgaacgtg
ttcgaactcatgaagatgatgattgaggccggcgccgcgggcgttcacttcgaagatcag
ctgtcatcggagaagaagtgcggtcacatgggcggcaaggtgctcatccccacgtcgcac
gcggtgcggaatctgacggccgcccgtctcgctgccgatgtgctcggcgtgccgacggtc
atcgtggcgcgcacagacgccaacggcgcgttcctcatcacgagcgatgtcgacgatcgc
gacgcgcggttcatcaccggcgagcgcacgccggaagggttctaccggttccggggcggg
ctggaggccgcaattgcccgcggactcgcttatgcgccgtacgcggacatgatctggtgc
gagacgtccgagccgaacatcgaggaagcgaagcggtttgcggaggccatcaaggccgaa
ttcccggataaacttctggcctacaactgctcgccctctttcaactggcggaagaagctc
gatccgaagaccatcgaggagttccaggagatcatcgcgtcgttcggctacaagttccag
ttcgtgaccctggcgggcttccacgccctcaactacagcatgttcgagctcgcgtatggc
tacaaccagcgcggcatgggggcgtactcggacctgcagcagcaggagttcgcggcggag
gcccgtggctacacggcgacacgccatcagcgggaggtgggcacgggctacttcgatgaa
gtggcgcaggtggtgtcgggcgggctctcgtccacgacggcgctcaccggctccacggag
gaggagcagtttgtggaggcgtga

DBGET integrated database retrieval system