KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0055Help
Entry
Aaci_0055         CDS       T00985                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Aaci_0055
Enzymes [BR:aac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Aaci_0055
Exosome [BR:aac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aaci_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
69155..70660
Genome map
AA seq 501 aa AA seqDB search
MDARTFILAFDQGTTSSRAILFDRAGRIHSIAQKEFTQIYPKPGWVEHDPMEIWGTQSGV
AREVLEKAAVSPEQVAAIGITNQRETTVVWDKETGKPVYNAIVWQDRRTADICDELKAAG
HADAIRDKTGLVIDAYFSGTKIKWILDHVEGARERAERGELLFGTIDTWLVWNLTRGKVH
VTDYTNASRTMLFNIHTLDWDDDLLKLLGIPRAMLPEVRPSSSIYGHTDEHTFGGANIPI
AGIAGDQQAALFGQTCFEPGMVKNTYGTGCFMLMNTGEKPVASPSGLLTTIAWGLDGKVT
YALEGSVFIAGAAIQWLRDGLRFFDAAADSEYFASKVEDTGGVYVVPAFAGLGAPYWDMY
ARGAIFGLTRGTRKEHIIRATLDSLAYQTKDILDAMQRDSGIELKSLRVDGGAVANNLLM
QFQADILGVPVERPRITESTALGAAYLAGLAVGFWSKDEIARSGDIERRFDPQMDAETRA
RLYRGWQRAVERTMGWAQEDI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggacgctcgaacgtttatcctcgccttcgaccaaggcacaaccagctcccgcgcgatt
ctgttcgatcgcgccgggcgcattcacagcatcgcccagaaggagttcacccagatctat
ccgaagcccggctgggtcgaacatgacccgatggagatctggggcacgcagagcggcgtc
gcgcgagaggtgctcgagaaggccgccgtgtccccggaacaggtggcggccatcgggatc
accaaccagcgcgagaccacggtggtgtgggacaaggagaccggcaagcctgtctacaac
gccatcgtctggcaggatcgccgcacggccgatatctgcgatgagctgaaggcggccggt
cacgccgatgccatccgcgacaagacgggccttgtcatcgacgcctacttctccggcacg
aagatcaaatggattctcgatcacgtcgagggcgcccgcgagcgcgccgagcgaggagag
ttgcttttcggtaccatcgacacctggcttgtgtggaacctgacgcgcggcaaggtccac
gtgacggactacacgaacgcgtcgcgcacgatgctcttcaacattcacacgctcgattgg
gacgacgatctcctcaagctgctcggcatcccgcgcgccatgctgcctgaggtccggccc
tcctcgtccatctacggccacaccgatgaacacacgtttggcggcgcgaacattcccatc
gccgggatcgcaggagatcaacaggcggcgctctttgggcagacgtgcttcgaaccgggt
atggtcaagaacacgtacggcaccggctgcttcatgctcatgaacacaggcgagaagccc
gtggcgtcgccgtccgggctgctgacgaccattgcctgggggctcgacggcaaagtcacg
tatgcgcttgagggaagcgtcttcatcgcgggcgcagcgattcagtggctgcgcgacggg
ctgcgcttcttcgatgcggcggccgactcggaatactttgcgagcaaggtggaggacaca
ggcggcgtgtacgttgtgccggcgttcgccggcctcggtgcgccgtattgggacatgtac
gctcgcggcgccatcttcggcttgacacgcggaacccgcaaggagcacatcatccgcgct
acgctcgattcgctcgcgtaccagacgaaagacatcctcgacgcgatgcagagggactct
ggcatcgagctcaaatcgctccgggtcgatggcggcgcggtggcgaacaacctgctcatg
cagttccaggcggacattctcggcgtgccggtggagcggccgcggatcaccgagtccacg
gcgcttggcgcggcgtatctcgccgggctcgcggtggggttctggtccaaggacgagatc
gcccggagcggagacatcgagcgccgtttcgatccacagatggacgcggaaacacgggcg
cgcctgtatcgcggatggcagcgcgccgtggagcgcacgatgggttgggcgcaggaggac
atctga

DBGET integrated database retrieval system