KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0086Help
Entry
Aaci_0086         CDS       T00985                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00010  Glycolysis / Gluconeogenesis
aac00052  Galactose metabolism
aac00500  Starch and sucrose metabolism
aac00520  Amino sugar and nucleotide sugar metabolism
aac00521  Streptomycin biosynthesis
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
aac01130  Biosynthesis of antibiotics
aac01200  Carbon metabolism
Module
aac_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aac_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aaci_0086
   00052 Galactose metabolism
    Aaci_0086
   00500 Starch and sucrose metabolism
    Aaci_0086
   00520 Amino sugar and nucleotide sugar metabolism
    Aaci_0086
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Aaci_0086
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Aaci_0086
Enzymes [BR:aac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Aaci_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Pan_kinase BcrAD_BadFG DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ACV57150
UniProt: C8WQ46
Position
108654..109595
Genome map
AA seq 313 aa AA seqDB search
MEQKLALGIDIGGTNVKLAIVRSDGRVLVDRSIPTAPERGPEAFSRTVGAEARAMANEAS
VAWDSVVGAGVGMAGFLDVERGWVEEAVNLHWRDVPLADLLQSALDKPVRVDNDANVAAL
GEVWLGAGQNAHTALCVTLGTGVGGGIVIGGRIHRGASTMAGEIGHIMVKNDGELCNCGH
RGCLETLASATALVRHAVAAGVKSPGGGELTAKEVFALAAEGDPAARAVVDDMIHWLAVG
LAVVANILNPDVIVVAGGLVNAGDQLMEPLRAAFQREALARVARACRLVPAKLGDQAGVL
GAARLVLQDIESL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaagcttgcgcttggcatcgacattggcggcacgaacgtgaagttggccatc
gtgcgaagcgatggccgcgtgttggtggacaggtccatccccacggctcccgagcggggg
ccggaggccttctcccgcacggtcggcgcagaggctcgtgccatggcgaacgaggcgtcc
gtggcgtgggactccgtcgtgggcgcgggcgtgggcatggcgggctttctggatgtggag
cgcggatgggtggaggaagccgtcaacttgcactggcgggatgttcccctcgcggatctg
cttcagtcggcgctagacaaacctgttcgcgtggacaacgacgccaacgtcgcggccctc
ggcgaggtgtggctcggcgcggggcagaacgcgcacaccgccctctgcgtcacgctcggc
acgggcgtcggcggcggtattgtcattggggggcgcatccaccgcggtgcctcgaccatg
gccggtgaaatcggtcacatcatggtgaaaaacgacggggagctttgcaactgcggccac
cgcggctgcctggagaccctcgcctcggccaccgcgctcgtgcgccacgccgtcgcggct
ggggtgaagagtccaggtgggggggaactcaccgcgaaagaggtctttgcgctggccgcg
gagggcgatccggccgcgcgcgcggtcgtcgacgacatgattcactggctggcggtgggg
ctcgcggtcgtggccaacatcctgaacccggacgtcattgtcgtcgccggcgggctcgtg
aacgcgggagatcagctcatggagccgcttcgtgccgcgtttcagcgggaagcgctggcc
cgagtcgcgcgcgcgtgcagattggtccccgcgaaactcggggatcaggccggcgtcctg
ggcgccgcccggctggtgctgcaggatatcgaaagcctgtga

DBGET integrated database retrieval system