KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0108Help
Entry
Aaci_0108         CDS       T00985                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Aaci_0108
DNA repair and recombination proteins [BR:aac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Aaci_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126939..127538
Genome map
AA seq 199 aa AA seqDB search
MYGYPEPVARAIEHFMKLPGVGPKTAARLAFHVLEMSEADVKAFAKALIDLKTGLTECAV
CCNITEASPCAICRDPRRDRRVICVVQEPRDVIAMERTREYHGLYHVLHGAISPMEGVGP
QDIRIRELVTRVGENEIEEVILATNPNVEGEATAMYISRLLKPFQVKLTRIAHGLPVGGD
LEYADEVTLAKALEGRRAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtacgggtacccggagccggtggcgcgggccatcgaacatttcatgaagttgcccggc
gttgggccgaagactgccgcgcgcctggcatttcacgtgctggagatgagcgaggccgac
gttaaagccttcgccaaggcgctgatcgatctcaagacggggctcacagagtgcgccgtc
tgctgcaacatcacggaagcgtctccgtgcgccatctgccgagacccacgccgagaccgg
cgcgtcatctgcgtcgtgcaggagccgcgggacgtgatcgcgatggagcgcacgcgcgag
tatcatgggctgtaccacgtgctgcacggcgccatctcgccgatggagggcgtgggcccg
caggacattcggattcgggaactggtgacgcgagtgggcgagaacgagattgaggaagtc
atcctcgccaccaacccgaacgtcgaaggcgaggcgacggcgatgtacatctcgcgcctg
ttgaagccgttccaggtcaagctgacgcgcatcgcgcatggcttgccggtgggcggcgat
ctcgagtacgcggacgaggtcacgctcgcgaaggccctcgagggcaggcgggcgctgtag

DBGET integrated database retrieval system