KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0174Help
Entry
Aaci_0174         CDS       T00985                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00900  Terpenoid backbone biosynthesis
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01130  Biosynthesis of antibiotics
Module
aac_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Aaci_0174
Enzymes [BR:aac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Aaci_0174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACV57237
UniProt: C8WQQ9
Position
192629..193507
Genome map
AA seq 292 aa AA seqDB search
MLFQRAYAKINLTLDVLGRRDDGYHEVDMVMQTVDLSDVVWLEARDDGEITMESTSSSVP
VDERNLCVQAAHAFRRRTGFAGGVHIQLEKHIPVAAGLAGGSSDAAAVLRGLNQLAGAGL
TLDELADIGAEVGSDVPYCVYGGLAIARGRGERVTRYAHVPAMYAVLLHPRIFVSTADVY
RGLQPSDFTSSPRSEEMVRCLAEGDHERAVSLVHNALERVTLSLYPELRALKERVTSIAQ
RPVHMSGSGPTMFVLTPVHTHAQRLYNALRGIMKDVYVCRFVGGYAHAHARS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgctttttcaacgcgcgtacgcgaagatcaacctgaccctggacgtcctcgggcgccgc
gatgacggctatcacgaggtggacatggtcatgcagaccgtggacctgtcggatgtcgtc
tggcttgaggcgcgagacgacggcgagatcaccatggagagcacgtcgtcctcggtgccg
gtggacgagcgcaacctgtgcgtgcaggcggcgcatgcgttcaggcgccgcacgggcttt
gcgggcggcgtgcacattcaactcgagaagcacatccctgtcgccgcggggctcgccggc
gggtcgagcgacgccgcggctgttttgcgcgggctgaatcagctggcaggcgcggggctt
acgttggacgagctcgccgacattggcgcagaggtgggctccgacgtgccctactgcgtc
tacggcgggcttgccattgcgcgcggtcgcggcgagcgcgtgacgcgatatgcgcacgtc
ccggccatgtacgcggtgcttctgcacccgcgcatcttcgtctcgaccgcggatgtctac
cgcggcctccagccctccgatttcacctcgtccccgcgcagcgaggagatggtgcgctgc
ctcgcggagggggatcacgagcgcgccgtttcgctcgtccacaacgccctggagcgcgtg
actctgagcctttatccggagcttcgggcgctcaaggagcgggtgacgtccatcgcgcag
cggcctgtgcacatgtccgggtcggggccgacgatgttcgtgctgacgcccgtgcacacg
cacgcccagcggctgtacaatgcgctccgcggcatcatgaaagacgtgtacgtgtgccgg
tttgtgggcggctacgcccacgcacacgcgcggagctga

DBGET integrated database retrieval system