KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0206Help
Entry
Aaci_0206         CDS       T00985                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Aaci_0206
Enzymes [BR:aac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Aaci_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
222451..222951
Genome map
AA seq 166 aa AA seqDB search
MAVPSLHDAYIGAGSNVGRRIVHLGFGIEGLKALGDIAAVSKVYETAPVGYLNQGDFLNL
AVHLRTPLSPHELLRGLLAIEARAGRTRDIRFGPRTLDLDLLLYDDLELDEPDLTLPHPR
MWQRAFVMVPLADLNPHRLAPTGETWADLAARLRQKDEVHEVGRFW
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcggttccttcgcttcatgacgcgtacatcggggccggatcgaacgtcggcaggcga
attgttcatctcgggttcggcatcgaggggctcaaggcgcttggcgacatcgccgcggtg
tccaaggtgtacgagaccgcgccggtgggctacctgaatcagggcgacttcctgaacctc
gccgtccacctgcgcacgccgctttcgccgcacgagctcctgcgcgggcttcttgccatc
gaggcgcgggccgggcgcacgcgcgacatccgcttcggcccgcgcacgctcgatctcgat
ctgctcctgtacgatgacctcgagcttgacgagccggatctcacgctgccgcacccgcgc
atgtggcagcgggcgtttgtcatggtgccgctcgcggatctcaatccccaccgcctcgcc
ccgaccggcgagacgtgggctgatctcgcggcgcgccttcgccagaaagacgaggtgcat
gaggttggacgcttttggtag

DBGET integrated database retrieval system