KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0265Help
Entry
Aaci_0265         CDS       T00985                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Aaci_0265
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Aaci_0265
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Aaci_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
292767..293264
Genome map
AA seq 165 aa AA seqDB search
MTIYDFEVEKADGTTMSMREYQGKVLLIVNTASKCGFTPQYEGLQKLYELYRDRGFEVLA
FPCNQFGNQEPGSNEEIQTFCSTTYRVTFPVFAKVDVNGPNAHPLFEYLKKQAKGALGSE
AIKWNFTKFLVDRDGRVVKRYAPQTSPESIREDIEACLVHASRGQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ttgacgatttacgattttgaggtcgagaaggctgacgggacgacgatgtcgatgcgggag
taccagggcaaggtgcttctcattgtgaatacggcgtccaagtgcggtttcactccgcag
tatgaaggattgcaaaagttgtacgaactctatcgcgatcgcggcttcgaggtccttgcc
tttccttgcaatcagtttggcaatcaggaaccgggatcgaatgaggaaattcaaaccttc
tgcagcacgacgtaccgcgtgacgtttccggtctttgcgaaagtcgacgtgaatgggccg
aacgcgcatccgctgtttgaatacctgaagaaacaggccaagggtgcactcggatcagag
gccatcaagtggaacttcaccaagtttctcgtcgaccgggacgggcgtgtggtgaaacgc
tacgcgccgcagacatcgccggagagcatccgcgaagacatcgaggcttgtcttgtccat
gcatcaaggggccagtga

DBGET integrated database retrieval system