KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0285Help
Entry
Aaci_0285         CDS       T00985                                 

Definition
heavy metal translocating P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
328725..331106
Genome map
AA seq 793 aa AA seqDB search
MSETRELTLPIEGMTCAACAARIEKNLAKLPGVQQVNVNLASERARVVLTPDTPWTEVVS
RIEKTGYSVPVREVDLRITGMTCAACAARIEKVVGRLEAVKEVHVNLASEKARVAYVPGV
IDVEDIIRAVEKAGYGAALASEVEAEEEARKRRAYRRDLATFFLSALLTLPLVVQMFVML
VGGRAFLPNWLAWLLATPVQFYVGWRFYKGAYHALRGGAANMDVLVALGTTVAYVFSAVL
TVEGRQDVYFDSSATVVTLIFMGKLLEARAKARSSAAISSLAKLGAKVAHVLRDGEETDV
PVEALAVGDLVRVRPGERVPADGVVVEGWTSVDESFLTGEPLPVTKRPGDEVVGASLNQT
NAFVMRVTKVGRDTALAQVIRLVERAQGSKAPVQRLADRISGIFVPAVLGVALVTFLVWG
ALGHWSHGLFAAIAVLVIACPCSLGLATPTAIMVGTGLGAERGILVKGGEHLETAHRVDT
VVFDKTGTLTMGKPAVTEIWAAEGVAEGDVLRLAAALEAQSEHPLGRAVVEAAKARGVEV
PAAMDVAAVPGRGIEGVVEGARVRVGSPSFVSSAAPGLPEKVRRKLAGPGRTVVVVAQEN
RLLGAIAMADEVKPDAHAAVDALRAMGMDVWMMTGDAEETARAVAARLGIEHVMAEVLPG
DKAAKVEALRKSGRVVAMVGDGLNDAPALAAADVGMAVGTGADVALEVADVALMRGDVWA
VVDALRLAKATMRKIRQNLFWALVYNVLGIPLAALGVLSPIIAGAAMALSSVSVVSNSLL
LRRTRMGANASAA
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaacccgcgaattgacgctgccgattgagggcatgacgtgcgccgcctgtgcg
gcgcggatcgagaagaatctggcgaagctgccgggtgtgcagcaggtgaacgtgaatctc
gcgtccgagcgagcccgcgtcgtgctgacgcccgacacgccgtggaccgaggtggtctcg
agaatcgaaaagaccggctactcggtcccggtgcgcgaagtggacctgcgtatcaccggg
atgacgtgtgccgcgtgcgctgcgcggatcgagaaggttgtcgggcgccttgaggcggtg
aaagaggtgcacgtgaacctcgcgtcggagaaggcgcgtgtggcgtacgtgccgggcgtg
atcgacgtcgaggacatcatccgcgcggtggagaaggcgggctacggcgcggcgctcgcg
agcgaggtggaagcggaggaagaggcgcgcaagcggcgggcgtatcggcgcgatctcgcc
acgttcttcctctccgccctcctcacgctgccgcttgtggtgcagatgttcgtcatgctg
gtgggcgggcgcgcgtttcttccgaactggctcgcctggcttctcgccacgcccgtccag
ttctacgtcggctggcgcttttacaagggggcctaccacgcgttgcgcggtggcgccgcg
aacatggacgtgctcgtggcgctcggcaccacggtggcgtacgtgttcagcgccgtcctg
acggtggaggggcgccaggacgtgtactttgacagttcggcgacggtcgtgacgctcatc
ttcatgggcaagctgctcgaggcgcgggccaaggcgagatcgagcgcggccatctcgtcg
ctcgcgaagctcggggcgaaggtggcgcacgtcctgcgggacggcgaggagacggacgtg
ccggtcgaggcgcttgctgtgggcgatctcgtccgcgtgaggccgggagagcgggtgcct
gcggacggcgtcgtggtggagggatggacgagtgtcgacgagtcgtttctgaccggcgag
ccgctgcctgtgacgaagcgccctggcgacgaggtggtgggcgcatccctgaaccagacg
aacgccttcgtgatgcgggtcacgaaggtgggccgggacacggcgctggcgcaggtcatc
cggctggtggagcgcgcgcagggatcgaaggcgccggtgcagcgcctggcggatcgcatt
tccggcatctttgtcccggccgtgctcggggtggcccttgtcacgttcctcgtctggggc
gcgctcgggcactggtcgcacgggctgtttgcggccatcgcggtgctcgtgatcgcctgc
ccgtgctcgctcggcctcgccacgccgacggccatcatggtgggcacggggctcggcgcc
gagcgcggcatcctcgtgaagggcggggagcatctggagacggcgcaccgggtggatacc
gtcgtctttgacaagacggggacgctgacgatggggaagcccgccgtgacggagatctgg
gcagccgagggcgtcgccgaaggggacgtgctgaggctggcggcggcgcttgaggcgcag
agcgagcacccgcttggccgcgcggtggtcgaggcggcgaaggcgcgcggcgtggaggtt
ccggcggcgatggacgtggcggccgtgccggggcgcgggatcgagggcgtggtggagggc
gcgcgcgtgcgcgtgggcagcccgagctttgtgtcctccgccgcgccgggcctgccggag
aaggtgcgccgcaagctcgcagggccgggccgcaccgtcgtggtggtggcgcaggagaat
cggctgcttggcgccatcgccatggccgacgaggtgaagccggatgcgcacgcggcggtg
gatgcgcttcgggcgatggggatggacgtgtggatgatgacgggcgacgcggaggagacg
gcgcgcgcagtggcggcgcgcctcggcattgagcacgtgatggccgaggtgttgccgggc
gacaaggcggcgaaggtggaggcgctgcggaagtccgggcgcgtcgtggccatggtcggc
gacgggctcaacgacgcgccggcgctcgccgcagcggacgtgggcatggcggtgggcacg
ggcgccgatgtggcgctggaagtcgcggatgtggcgctgatgcgcggcgatgtgtgggcc
gtagtcgacgcattgcgcctcgccaaggcgaccatgcgcaagatccggcagaacctgttc
tgggcgctcgtgtacaacgtgctcggcattccgctcgccgcgctcggggtgttgagccct
atcatcgcgggggccgcgatggccctgagctcggtcagcgtggtgtcgaacagcctgctc
ctgcggcgcacgcggatgggcgcgaacgcctccgccgcgtga

DBGET integrated database retrieval system