KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0321Help
Entry
Aaci_0321         CDS       T00985                                 

Definition
(RefSeq) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aaci_0321
  Amino acid metabolism
   00220 Arginine biosynthesis
    Aaci_0321
   00330 Arginine and proline metabolism
    Aaci_0321
Enzymes [BR:aac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Aaci_0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(370546..371442)
Genome map
AA seq 298 aa AA seqDB search
MKDIHIIGVPSDYGQNRRGVDMGPSAIRYAGLKEKLERLGYEVSDLGDVPVPTPETRQIE
HQKLKYLREVVSVCEALCEKVDGVLKGGHTPVILGGDHSIAIGSLAGIARAGQPFGVIWF
DAHGDMNTDETTPSGNIHGMPLAASLGLGHEALTGIGGIRPKVKPENVVLVGARSIDPEE
RELIRRSGIHVFTMQDVDRRGMDAVMQEAIRIASDGTRGIHLSLDLDALDPMFAPGVGTP
VNGGFTYREGHLAMELLAASGKLLSVDVVEVNPILDHRNQTGRMAVELLESLFGKRVM
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacattcacatcatcggcgtcccgtccgactacggccagaaccgccgcggcgtg
gatatgggcccgagcgccatccgctacgcggggctgaaggagaagctcgagcggctcggc
tatgaggtgtccgatctcggcgacgtgccggtaccgacgccggaaacgaggcagattgag
caccagaagctgaagtacctgcgcgaggtggtctcggtctgcgaggcgctctgcgagaag
gtggacggcgtgctgaagggcgggcacacgcccgtcattctgggcggcgatcactccatc
gccatcggtagcctggccgggatcgcacgcgcagggcagccgtttggcgtcatttggttt
gacgcgcacggcgacatgaacacggacgagacgacgccgtcgggcaacatccacggcatg
ccgctcgccgcgagcctcggcctcggccacgaggcgctcaccggcatcggggggattcgc
ccgaaggtgaagccggagaacgtggtgctcgtcggcgcgcggtccattgatcccgaggaa
cgcgagctgattcgccggtccggcattcacgtgttcaccatgcaggacgtcgatcgtcga
ggcatggacgcggtcatgcaggaggccattcgcatcgcgtcggacggcacgcgcggcatc
cacctgagcctcgatctcgacgccctcgaccccatgttcgccccgggcgtcggcacgccg
gtcaacggcggcttcacctaccgggagggccatctcgccatggagctgttggccgcgagc
ggcaagctcctctcggtcgacgtcgtcgaggtgaaccccattttggatcaccggaaccag
acgggccgcatggccgtggaactcttggaatcgctgttcggcaagcgggtgatgtga

DBGET integrated database retrieval system