KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0321Help
Entry
Aaci_0321         CDS       T00985                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aac01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aac00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(370546..371442)
Genome map
AA seq 298 aa AA seqDB search
MKDIHIIGVPSDYGQNRRGVDMGPSAIRYAGLKEKLERLGYEVSDLGDVPVPTPETRQIE
HQKLKYLREVVSVCEALCEKVDGVLKGGHTPVILGGDHSIAIGSLAGIARAGQPFGVIWF
DAHGDMNTDETTPSGNIHGMPLAASLGLGHEALTGIGGIRPKVKPENVVLVGARSIDPEE
RELIRRSGIHVFTMQDVDRRGMDAVMQEAIRIASDGTRGIHLSLDLDALDPMFAPGVGTP
VNGGFTYREGHLAMELLAASGKLLSVDVVEVNPILDHRNQTGRMAVELLESLFGKRVM
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacattcacatcatcggcgtcccgtccgactacggccagaaccgccgcggcgtg
gatatgggcccgagcgccatccgctacgcggggctgaaggagaagctcgagcggctcggc
tatgaggtgtccgatctcggcgacgtgccggtaccgacgccggaaacgaggcagattgag
caccagaagctgaagtacctgcgcgaggtggtctcggtctgcgaggcgctctgcgagaag
gtggacggcgtgctgaagggcgggcacacgcccgtcattctgggcggcgatcactccatc
gccatcggtagcctggccgggatcgcacgcgcagggcagccgtttggcgtcatttggttt
gacgcgcacggcgacatgaacacggacgagacgacgccgtcgggcaacatccacggcatg
ccgctcgccgcgagcctcggcctcggccacgaggcgctcaccggcatcggggggattcgc
ccgaaggtgaagccggagaacgtggtgctcgtcggcgcgcggtccattgatcccgaggaa
cgcgagctgattcgccggtccggcattcacgtgttcaccatgcaggacgtcgatcgtcga
ggcatggacgcggtcatgcaggaggccattcgcatcgcgtcggacggcacgcgcggcatc
cacctgagcctcgatctcgacgccctcgaccccatgttcgccccgggcgtcggcacgccg
gtcaacggcggcttcacctaccgggagggccatctcgccatggagctgttggccgcgagc
ggcaagctcctctcggtcgacgtcgtcgaggtgaaccccattttggatcaccggaaccag
acgggccgcatggccgtggaactcttggaatcgctgttcggcaagcgggtgatgtga

DBGET integrated database retrieval system