KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0522Help
Entry
Aaci_0522         CDS       T00985                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Aaci_0522
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Aaci_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
579966..581378
Genome map
AA seq 470 aa AA seqDB search
MKRVAIIGGGIAGLSACLALVKALDKYPTEIILYEASNRLGGHVHTIHDPSLDLTVEAGP
DSILARKPASIHLLKSLHLEHEIVHARQSAGNIFIVRDGKLHKVPNGYMGIPCSDTAVES
NLLSREGKQRVLAEECLPVQDVSVDMSLGAFLRGRLGDEWVEYIGEPLLAGLYAGAIDKL
SLLATWPFLVNLMREHGSLVAASRVIAMVGRSSSTTGGFVSVRGGLELIIERMLGQICEH
RSADIRLGARVLSITKDGHRYRVTAETEGGNRTVDDVDGAIITVPSFVAQSILKPILELP
DTGVFYQSTATVVLVYERHAIDIDLEEASGFLVPRPEGMTITATTWVSSKWPHISPPEYA
VIRAYVGRRDQDQALTLSDADLVRSVTKEVGKLLGTDACPIRHYITRFDKAMPNYAVHHL
CRVEKIEATLKQKCPGIFLAGAGYRGVGLPDCVEQGTRAAEHILASLFQV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgttgctattatcggtggtggcattgcagggttgtccgcatgtcttgcgctc
gtcaaggccttggacaaatatccgacagaaatcatattgtatgaggccagcaatcgcctt
gggggacacgtgcatacaattcacgatccctctcttgaccttacagttgaagccggacct
gattcgattttagcacgaaaacccgccagtatacatctcttaaagtcacttcacttagaa
cacgagattgttcatgctcgacaaagtgcaggtaatatcttcattgttcgggatggcaaa
ttgcacaaggttccaaatgggtatatgggcattccatgcagtgacactgctgtggaatca
aatctacttagtcgcgaaggaaaacagcgagtgttggcggaagaatgtcttccagttcag
gatgtgagtgtcgacatgtcgctgggtgcgtttttgcgcggtcggcttggagacgaatgg
gttgaatatatcggtgagcctcttctcgctggtctttacgcaggagcgatagataaacta
tctctccttgcaacttggccatttttggtcaatttgatgcgagaacatgggagcctagtt
gcggctagccgtgtgattgcaatggttgggaggtcttctagcacgactggtggatttgtg
tccgttcgaggcggcttagaattaattattgaaagaatgttgggacaaatttgtgaacat
cgtagtgctgatattcggttgggggcgcgtgtgctttcaatcacgaaggacgggcatcga
tatcgtgtcactgctgagacggaggggggcaatcgaaccgtggatgacgtggacggggca
atcattacagttccttcgtttgttgcacaatctatacttaaacccatacttgaacttccg
gatacgggagtgttttatcagtctactgccactgttgtgttagtgtatgagagacatgca
atagatatcgatttggaagaggcgtctggctttctagtacctcgaccggaggggatgact
attacggcaacgacttgggtgtccagtaaatggccacatatatctccgccagaatatgca
gtcattcgcgcgtatgttgggcgaagagatcaggaccaggcactgaccttgtctgatgca
gatctcgttcgatctgtcacgaaagaggtggggaaactcttagggactgatgcttgcccg
attcgtcattatattactcgctttgataaggcaatgcccaattatgcggtgcatcatctg
tgtcgggttgagaaaatcgaagccactcttaagcaaaaatgccccggtatcttcttggcc
ggagcgggctatcgtggagtaggactgccggactgtgtagaacaaggaacacgagcggcc
gagcatattttggcttcactatttcaggtttga

DBGET integrated database retrieval system