KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0673Help
Entry
Aaci_0673         CDS       T00985                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:aac02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:aac02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
719153..722800
Genome map
AA seq 1215 aa AA seqDB search
MSQPHDLMRVPLYVVGIGASAGGLEALTNLFDKLAPDTGMAFVVIQHLSPNYRSFMAELL
GAHTSMPVLQAEDGMPLEPNRVYLNPPRKNVFVDAGRLVVQDHLTVKGELHLPIDGCLQS
IAEYAGDRAVAVILSGTGSDGSRGIVRVKQRGGRVFVQDETAKFDGMPKSAVATGTVDAV
LSPDAIAKELERIARGEQSVSTFSPPSVTIEDDGHEELDDARYQELLEILKSSTGIDYTV
YKRDGVIRRLRRRMGIENISDVNHYFEALRQNPDAVEALHKDLLIGVTRFFRDPQAFQVI
YQDVLPQIFANRQTEREVRVWVAGCSTGEEAYSLAILIQEFMESIGQIYNVKIFATDLDR
DAVAFASNGVYGTEIQNDVSAERLRKFFVPCERGYRVKPDIRKMIIFAPHNITKDPPFIN
TDLISCRNMIIYLRREIQEKVLSLFHFALHPKGFLFLGPSESIGRMSNSFVPINTKWNIY
QHQGASCANRRPIIPPVTVPVKSASLPASHMVERRVDADSWASSRQADPHTDELYRVFVE
EHFPPCIVLDEKNDVVSMHGDVNRYLSLASGRPSNHIHKMFPPSISVAIATGVSKLKKGS
REVIYDRVKVNDSPDSATVTLVIRQLSDRLNRFRSHALVMFREPEPLEAVVYAGDDVSST
VSQRVIELERELQMYQEKLQVTVEELETSNEELQATNEEIVAANEELQSTNEELHSVNEE
LLTINAEYQLNIQQLTELTNDLDNFLASTEIGTLFLERELKVKRFTPALTKEFHLLDIDV
GRPITHISHRLEYDEMIDDAKSVLANGEPIEREVHSKSGAWYAVRVLPYHTPEQAVKGVV
FTFVDITKIKKMNEELRKLSYAVEQSPSIVVITDTEGRIEYVNPKFCACTGSSVEEALGR
HLRDLNEWAEQNLSFDDVWSNLQAGERWTGEVPSRRKDGTLYWEQLSIVPILDETGRIIH
YLKVAEDVTEFRYTEELLRKSEMLSAVGELAAGIAHEIRNPLTALKGFTKLILSGSHSDS
YLEIMRGELDRIETIVNELLVLSKPQAVHIQRRNFADILRDVVMLLETQALLTHVDIELR
IPDEPIEILCVENQLKQVFINLLKNAIEAMPNGGTIEVTVERDGDHVVIRVRDEGVGIPQ
DKMKKLGEPFYTTKDKGTGLGLMVSFKIVEQHGGIIRYESKEGEGTTVTVRLPLDMNSKA
RGLTPGDLNPGTVYA
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcagcctcacgatttgatgcgtgtaccactatacgtcgtcgggattggcgcgtca
gccggcgggctcgaagcgctgacgaacctgtttgacaaactggcgcccgataccggcatg
gcttttgtggtcattcaacatctgtctcccaactatcgcagctttatggcggaattgctg
ggggctcacacgtcgatgcccgtgctccaggcggaggacgggatgccgcttgagccaaat
agggtgtatctgaatccgccgcgcaaaaatgtctttgtcgatgccggacggctagtggtt
caggatcacctcacagtcaagggggaactgcatcttccgattgatggctgtctgcaatcc
atcgcggagtacgcaggggaccgggccgtggcggtcattctttccggcacggggagcgat
ggctcgcgcggaatcgtgcgtgtaaaacagcggggaggtcgtgtgttcgtccaagacgaa
acggcgaagtttgacggcatgccgaaaagcgctgtcgccaccggtaccgtggacgctgtc
ctctccccggacgccatcgccaaagaactggaacgcatcgcgcgcggagaacagtccgtt
tcgactttctcccccccgtccgtgactatcgaggatgacggccacgaagagttggatgac
gcgcggtaccaggagcttcttgaaatcctgaaatcctccacaggcattgactacaccgtg
tacaagcgagacggcgtcatccggcggctgcgtagacgcatgggcattgaaaatatttcg
gatgtaaatcactattttgaggctctgcgccaaaatccggatgccgtcgaggcgctgcac
aaggatctactcatcggtgtgacgcgatttttccgagatccgcaggcgtttcaggtcatt
taccaggacgtgctgccccaaatcttcgccaatcgtcaaacagagcgggaggtgagggtg
tgggtcgcaggatgctcgactggagaagaggcgtattccctcgcgattctcatccaagaa
ttcatggaatcgattgggcagatctacaacgtcaaaatctttgccactgacctcgatcgc
gacgccgttgcctttgcctccaatggtgtctacggaaccgagattcagaacgatgtcagc
gctgagcgtctgcgcaagttcttcgtgccctgtgagcggggctaccgcgtgaagccggat
attcgcaagatgatcatcttcgcgccgcacaatatcaccaaggatccgcctttcatcaac
acggatctcatctcgtgtcgcaacatgatcatctacctgcggcgagagattcaggagaag
gtcctaagtctctttcactttgcgctgcacccgaagggattcctattcttgggcccaagt
gagagcattgggagaatgtcaaattcgtttgtaccgataaatacaaaatggaatatctat
caacaccagggggcgtcttgcgcgaaccggcggccgatcattccgccggtcacggttccc
gtcaagtctgccagcctaccggcttctcacatggtggagcggcgggtggatgcagactct
tgggcttcgtcccgacaggcggaccctcatacggacgagctttaccgcgtgttcgtggag
gaacattttccgccttgtatcgttctcgatgaaaagaacgacgtggtgtcgatgcacggt
gacgtcaaccggtatctctcgctcgcgagtggtcggcccagcaaccatattcacaagatg
tttccaccctccatttcggtcgccattgccaccggtgtgagcaagctgaagaagggcagc
cgcgaagtgatttacgatcgcgtcaaggtgaacgactcgcccgactccgcaaccgtgacg
ctcgtcatccggcagctctcggacaggcttaatcgcttccgatcgcacgcccttgtcatg
tttcgagagccggagccgcttgaggctgtcgtttacgctggggacgacgtgtcttcgact
gtgagccaacgcgtcatcgagttggagcgggagctccagatgtaccaggagaagttgcag
gtgaccgtggaggaactcgagacctcaaatgaagagctccaggccaccaacgaagagatt
gtcgcggcgaatgaagaacttcagtcgaccaacgaagagctccattcggtgaatgaagaa
ctcttgaccattaacgcggaatatcagttgaacatccaacagctgaccgagctgacaaac
gatctcgacaattttctcgcgagcacggaaatcggcacgctgttcctggaacgggaactg
aaggtcaagcggtttacgcctgccttgacgaaggagtttcatttgctcgacatcgacgtg
gggcggcccatcacacatatttcgcatcggctcgagtatgacgagatgatcgacgatgcc
aagagcgttctcgccaacggggagcccatcgagcgagaggtccattcgaagtccggggcc
tggtatgcggtgcgtgttctgccgtaccacacacccgagcaggcggtgaagggcgtcgta
ttcaccttcgtggacatcaccaagatcaagaagatgaatgaagagcttcgtaagctttcc
tatgcggtggaacagagcccgtcgattgtcgtcattacggatacggagggccggatcgag
tacgtgaatcccaagttctgcgcgtgcactggttcttcggtcgaggaagcgctcggcagg
catctgcgcgacctcaacgaatgggcggagcagaatctatcgtttgacgacgtgtggtcg
aatttgcaggcgggcgaaaggtggacaggagaggtcccgagtcggcgcaaggacggaacc
ctttactgggagcaactttccattgtccccattctggatgaaacgggacgcatcattcat
tacttgaaggtggcggaggatgtgaccgagtttcgatacacggaggagttgctccgcaag
tcggaaatgctgtccgcggtcggagagctggctgctggaattgcccatgagattcggaat
ccgttgaccgcgctgaagggattcacgaagctcattctgagcggttcgcacagcgactcg
tacttggaaatcatgcgaggcgagttggatcgaattgagaccattgtaaacgagcttctg
gtgttgtcaaagccgcaggcggtgcacattcagcgtcgcaatttcgccgatatcctgcgt
gatgtggtgatgttactcgagacacaggcgttgttaacacacgtcgatatcgaactccgc
atacccgacgagcctattgaaatcctgtgtgtggagaatcagctgaaacaggtgttcatc
aacctgttgaaaaatgccatcgaggccatgcccaacgggggcaccatcgaggtcacggtg
gagcgggacggtgatcacgtcgtcatccgggtacgggacgagggcgttgggatcccgcag
gataaaatgaaaaaactgggtgaaccattctacactacaaaggacaaaggcacagggctc
ggcctgatggtcagctttaaaattgtagagcagcacggcgggataattcgttatgagagc
aaagagggcgagggcacgaccgtcaccgttcgattgccgctggacatgaattcgaaggcg
cggggccttacaccgggggacttgaacccagggaccgtttacgcttga

DBGET integrated database retrieval system