KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0725Help
Entry
Aaci_0725         CDS       T00985                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:aac01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(771749..772549)
Genome map
AA seq 266 aa AA seqDB search
MAMDMRRRRFTVWLGACAVVCAVSACGTNAADSAPTAPESAQSAARQASPYPLIAHPSAQ
PVVAMGVGGSVAHGWDDKTGGGYLVRAFQKLTKTGPISFQFINKSIEGYGPTQMAAKYAE
FLSEIHPQVVVISWGMLDDIANKTPIAAFEQAVQSEIRQALAAHADVVVVTPPPTGASYG
HDQASESQLVADEIRVAKQFKTPEVIVVDLFNQMKRYLAAHRQSIQMYSADDWHPNTLGH
ELAGSLLAQDLQGTLVPAGSAKPSSG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggccatggacatgagaaggcgtcgcttcacggtgtggcttggcgcctgcgcggtcgtc
tgcgccgtcagcgcctgcgggaccaacgcggcggacagcgcgcccacggcgcccgaaagc
gcgcagtcggcggcgcgacaggcgagtccctatccgctcattgctcacccgtcggcgcag
ccggtcgtcgcgatgggtgtcggcggctccgtcgcacacggatgggatgacaagaccggc
ggaggctatctcgtgcgagcgtttcagaaactgacgaagaccggccccatatcctttcag
ttcatcaacaaatccatcgaaggttacggccccacgcagatggcggccaaatacgccgag
tttctcagcgaaatccatccccaggtcgtggtcatctcgtggggcatgttggatgacatc
gccaacaagacgcccatcgccgcgtttgaacaagccgttcaatctgaaattcgacaggcg
cttgccgcgcacgcggacgtggtcgtcgtcacaccgccgcccaccggtgcatcctacggg
cacgatcaagcgtccgaaagccaactcgtcgcggacgaaattcgcgtggcaaaacaattc
aagaccccggaggtgatcgtcgtcgatttgtttaaccagatgaagcgctacctcgccgcc
catcgccagtccatccagatgtacagcgcggacgactggcaccccaacacgctcggccat
gaattggcgggatcgcttttggcccaggatctgcagggcacactcgtgcctgccggcagc
gccaaaccgagctcaggatga

DBGET integrated database retrieval system