KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0742Help
Entry
Aaci_0742         CDS       T00985                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aaci_0742
   01230 Biosynthesis of amino acids
    Aaci_0742
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aaci_0742
   00051 Fructose and mannose metabolism
    Aaci_0742
   00562 Inositol phosphate metabolism
    Aaci_0742
Enzymes [BR:aac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Aaci_0742
Exosome [BR:aac04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Aaci_0742
  Exosomal proteins of bladder cancer cells
   Aaci_0742
  Exosomal proteins of melanoma cells
   Aaci_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
794045..794815
Genome map
AA seq 256 aa AA seqDB search
MARTPLLMGNWKMYKTVAEARAFAEALGQQSQKLDSRIEYAICAPYTCLHVLRVMLPAQV
RLGAQNVFPEKEGAYTGEIAPGMLAEFGTKYVLAGHSERRMLFGESDQFINQKIKAIVAN
GMTPVLCVGENSSQKEDGVTKEVVTGQVLQGLDGLTADEVGRAVVAYEPVWAIGSGKTAT
PDDAEEVARAIRAAVAETWSPEAAEGLRILYGGSVKPDNVASFVREPDLDGALVGGASLD
PTSFAAMAEAIKGVLE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggacgccccttctcatgggcaactggaagatgtacaagacggtggcggaggcc
cgggcgtttgcggaggccctcgggcagcagtcgcagaagctcgacagccggatcgagtac
gccatttgcgcgccgtacacgtgcctgcacgtcctgcgcgtgatgttgccggcgcaggtg
cggctaggtgcccagaacgtgtttccagaaaaggaaggtgcgtatacaggcgagattgcg
ccgggcatgcttgccgagttcgggacgaaatacgtcctggctggacactcagagcgccgc
atgctgttcggcgagtccgatcagttcatcaatcaaaagataaaggccatcgtggcgaac
ggcatgacgccggttctgtgcgtcggggagaactcgtcgcagaaggaggacggcgtgacc
aaggaggtggtcacgggccaggtgttgcaggggctcgacggcctcaccgcggatgaggtg
gggcgcgcggtcgtcgcgtacgagccggtctgggccatcgggtccggcaagacggcgacc
cccgacgacgctgaggaagtcgcgcgggccattcgcgcggccgtggcagagacctggtcg
cccgaggcggcggagggtctgcgtattctgtacggagggagcgtcaagcccgacaatgtg
gcgtcgttcgtccgcgagcccgatctcgacggcgcgctcgtgggcggcgccagcctggat
cccacgtcgttcgcggccatggcggaagccatcaagggggtgctcgaatga

DBGET integrated database retrieval system