KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0742Help
Entry
Aaci_0742         CDS       T00985                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aaci_0742
   01230 Biosynthesis of amino acids
    Aaci_0742
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aaci_0742
   00051 Fructose and mannose metabolism
    Aaci_0742
   00562 Inositol phosphate metabolism
    Aaci_0742
Enzymes [BR:aac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Aaci_0742
Exosome [BR:aac04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Aaci_0742
  Exosomal proteins of bladder cancer cells
   Aaci_0742
  Exosomal proteins of melanoma cells
   Aaci_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
794045..794815
Genome map
AA seq 256 aa AA seqDB search
MARTPLLMGNWKMYKTVAEARAFAEALGQQSQKLDSRIEYAICAPYTCLHVLRVMLPAQV
RLGAQNVFPEKEGAYTGEIAPGMLAEFGTKYVLAGHSERRMLFGESDQFINQKIKAIVAN
GMTPVLCVGENSSQKEDGVTKEVVTGQVLQGLDGLTADEVGRAVVAYEPVWAIGSGKTAT
PDDAEEVARAIRAAVAETWSPEAAEGLRILYGGSVKPDNVASFVREPDLDGALVGGASLD
PTSFAAMAEAIKGVLE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggacgccccttctcatgggcaactggaagatgtacaagacggtggcggaggcc
cgggcgtttgcggaggccctcgggcagcagtcgcagaagctcgacagccggatcgagtac
gccatttgcgcgccgtacacgtgcctgcacgtcctgcgcgtgatgttgccggcgcaggtg
cggctaggtgcccagaacgtgtttccagaaaaggaaggtgcgtatacaggcgagattgcg
ccgggcatgcttgccgagttcgggacgaaatacgtcctggctggacactcagagcgccgc
atgctgttcggcgagtccgatcagttcatcaatcaaaagataaaggccatcgtggcgaac
ggcatgacgccggttctgtgcgtcggggagaactcgtcgcagaaggaggacggcgtgacc
aaggaggtggtcacgggccaggtgttgcaggggctcgacggcctcaccgcggatgaggtg
gggcgcgcggtcgtcgcgtacgagccggtctgggccatcgggtccggcaagacggcgacc
cccgacgacgctgaggaagtcgcgcgggccattcgcgcggccgtggcagagacctggtcg
cccgaggcggcggagggtctgcgtattctgtacggagggagcgtcaagcccgacaatgtg
gcgtcgttcgtccgcgagcccgatctcgacggcgcgctcgtgggcggcgccagcctggat
cccacgtcgttcgcggccatggcggaagccatcaagggggtgctcgaatga

DBGET integrated database retrieval system