KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0786Help
Entry
Aaci_0786         CDS       T00985                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Aaci_0786
  Lipid metabolism
   00561 Glycerolipid metabolism
    Aaci_0786
   00600 Sphingolipid metabolism
    Aaci_0786
Enzymes [BR:aac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Aaci_0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
848652..850856
Genome map
AA seq 734 aa AA seqDB search
MPIIFHSDERLFHLMTPRSSYVFRVGHDGLLEHVYWGARLEDASDLVRLARACQRLDARP
EHMRAIDIGSLRLEYPSFGTGDHRDPAYEVLQPSGSHASQLVYESHQIRPGKPPLPGLPA
FYVESDFEADTLEISLVDPAISLRVILSYTAYRDFDLVCRHARLENAGTEPLVLRRALSA
SVDLDLREADFVQLSGAWIRERFIQRTPLSPGRHEIMSRSGASGHKHNPFFALAAPHTTE
EGGEVRAFALVYSGNFLGACEMEPMRQNVRAQIGIHPSDFSWRLEPGERFVTPEAALVYS
DEGWGGMSRTFHRAIRKRLCRGTYRDRVRPVLINNWEATYFHFDEEDLVEIAEQARDLGA
EMFVLDDGWFGQRDDDHTSLGDWWPHPRKLPNGLRHLADRIHALGLRFGIWMEPEMVSPK
SELYREHPDWCLHVADRPRSERRHQLMLDLTREDVRAFVVNAVSRVIEEGAVDYIKWDMN
RPMTEVGSAALPPERQREVAHRYVLGLYEILETLTSRFPNVLFENCASGGGRFELGMLHY
MPQTWTSDNTDAVSRLKIQHGTSLVYPPVAMGAHVSAVPNHQMGRVTPFALRAGVAMCGN
FGFELDPRRLSDAERREARQAVERYKALRHLVQFGDFYRLLSPFDGPEAAWMFAVEDGSE
ALVAYFCTYPDPLDPPARVVLRGLRPEARYRCEALGESFRGDALMRHGLVIPRQVGDGQA
VLIHLKQIGEGDRP
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcatctttcactcggatgagcgcctgtttcacctgatgacgccgagatcgagc
tacgtgtttcgcgtcggccatgacggcttattggaacacgtctactggggcgccaggttg
gaagacgcgtcggacctggtccgcctggcgcgcgcttgccagcggctcgatgcgcggccg
gagcacatgcgcgccatcgacatcggctcgcttcgcctcgagtacccctcattcgggacg
ggcgaccaccgcgatcctgcctacgaggtcttgcagccttcgggcagccacgcgtcccag
ctcgtgtacgaatcccaccagatccgacctggcaagccgccgcttccgggcctgcctgcg
ttttacgtcgaatccgatttcgaagcggacacgctcgagatttcgctggtcgatccggcc
atctcgctgcgcgtgatcctctcctacaccgcctaccgcgacttcgatctcgtctgccgc
cacgcgcgcttggagaatgcgggtaccgaaccgctcgtcctgcgccgggcgctctccgca
tctgtcgatctcgacctgcgggaggcggacttcgtccaactctccggcgcctggatccgc
gagcggttcatccaacggacgccgctttcgcctgggcggcatgagatcatgagccgctcc
ggcgcgagcggtcacaagcacaacccgttcttcgccctcgcggcgccgcatacgacggag
gaaggcggcgaggtgcgcgcgttcgctctcgtgtacagcggcaattttctcggcgcctgc
gagatggagcccatgcggcaaaacgtgcgcgcgcagatcggcatccacccttccgatttc
tcctggcgcctcgaacccggcgagcggtttgtcacgcccgaggcggcgctcgtctactcg
gacgagggatggggcggtatgtcgcgcacgttccaccgcgccattcgaaagaggctgtgc
cgagggacctatcgcgatcgcgtccgccccgtgctcatcaacaattgggaagcgacgtac
ttccatttcgacgaggaagatctcgtcgagatcgcagagcaagcccgcgatctcggcgcg
gagatgttcgtcctcgacgacggctggttcggccagcgcgacgacgatcacacgtcgctc
ggcgactggtggccgcacccgcgcaaactgccgaacgggctgcgccatctcgccgatcgc
atccacgcgctcgggcttcgcttcggcatctggatggagccggagatggtgtcgccgaag
agcgagctgtatcgtgagcatccggattggtgcctgcacgtggcggatcggccgagatcg
gagcgaaggcatcagctgatgctcgacctcacgcgcgaggatgtgcgcgccttcgtggtg
aacgcggtgtcgcgcgtgatcgaagaaggggccgtcgattacatcaagtgggacatgaat
cggccgatgaccgaggtcggatcggccgcgcttccgcctgagcgccagcgcgaggtcgcg
caccgctacgtgctcgggctgtacgagatcctggagacgctcacgagccgattcccgaac
gtgctatttgaaaactgcgcctcgggcgggggcaggttcgaactcggcatgctccactac
atgccgcagacgtggacgagcgacaacacggacgccgtctcccggctgaagatccagcac
ggcacgagcctcgtctatccgccagtcgcgatgggcgcgcacgtgtcggccgttccaaac
caccagatggggcgcgtcacgccgttcgccctccgcgccggcgtcgccatgtgcggcaac
ttcggcttcgagctcgatccgcggcgcctttcggacgcggagcggcgcgaggcgcgtcag
gcggtggagcggtacaaagcgcttcgacacctcgtgcagttcggcgacttctaccggctg
ctgtccccgtttgacgggcccgaggcggcctggatgttcgctgtcgaggatggcagcgag
gcgctcgtcgcctatttctgcacgtatccggatcccttggatccgccggcgcgcgtggtc
ctgcgcggcctgcggcccgaggcgcgctataggtgtgaggcgctcggcgagagcttccgc
ggcgacgcactgatgcgccacggcctcgtcattccgcgccaggtgggcgacgggcaggcc
gtgctcattcatctcaagcaaatcggggaaggtgatcgcccgtga

DBGET integrated database retrieval system