KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0797Help
Entry
Aaci_0797         CDS       T00985                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aac00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aac00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
869322..870620
Genome map
AA seq 432 aa AA seqDB search
MDKIAFIGAGSTVFAKNVLGDCMLTPSLRGFEFALFDIDEERLKDSERMLLNLKEQLRAD
VHIQAYRDRKQALTGAKYVINAIQVGGYEPCTVIDFEVPKKYGLRQTIGDTVGIGGIFRA
LRTIPVMLSIAEDMQEVCPDAWFLNYTNPMAVLTNIMITHGGIKTVGLCHSVQVCVPNLF
RSLNMDPEGVEYKIAGINHMAWLLEVKKDGVDLYPEIKRRAREKQKQKHEDMVRFEIMDK
FGYYVTESSEHNAEYHPYFIKRTHPELIENLNIPLDEYPRRCVAQIEQWRQMRKSLVENK
NLQHTRTHEYASYLLEAMETNQPYKLGGNVMNTGLIENLPREACVEVPCLVDASGVTPTY
VGRLPEQCAALNRTNINTQLMTIEAAITRKREAVYQAAFLDPHTASELTLDEIVALCDDL
IEAHGNWLPEFH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcgcattcatcggagcgggaagcacagtttttgcaaaaaacgtactcgga
gactgcatgttgacaccgtcattgcggggatttgagtttgctctattcgacatcgacgag
gaaagactaaaagattctgaacggatgctgctcaacctgaaggagcaattgcgtgccgat
gttcacattcaggcctaccgtgatcggaagcaggcgcttaccggagcgaaatacgtgatt
aacgcaattcaggtcggtggctacgagccgtgtacggtcatcgactttgaagttcccaaa
aaatatggactcagacaaacgatcggagacacagtaggtataggagggattttccgtgca
ttacgcacgattcctgtgatgctttcgattgcagaagatatgcaggaggtttgtcctgac
gcttggttcctaaactacacaaacccgatggctgttctgacgaacatcatgattacacac
ggcgggatcaagacggttgggttatgtcacagcgtgcaggtttgcgtgccgaatctgttc
aggtcgctgaacatggatcctgaaggagttgaatacaagattgctgggatcaaccacatg
gcctggcttctagaggtcaagaaggacggtgtagacctatatccagaaattaagcgccgg
gctagagagaagcagaagcaaaagcatgaagacatggttcgatttgaaataatggataaa
tttggttattatgtgactgagtcgtctgagcacaatgcagaatatcacccgtacttcatt
aagcgaacccaccccgaattaatagaaaatctgaatataccgttagacgaatacccacgt
cgatgcgtagctcaaattgagcaatggcgtcagatgagaaagtcactagttgagaataag
aacctgcagcatacacggacacatgaatacgcttcgtatctgttagaagctatggagacc
aaccagccatacaagctcggtggcaatgttatgaatacgggattaatcgaaaacttgccg
agagaagcgtgtgttgaagtaccttgcttagtggacgcgagtggagtgacgccaacttac
gtggggcgtctgcctgaacaatgcgcggctttaaaccgtacgaatattaacacccaactt
atgaccatcgaagcggcaataacacggaaaagggaggcggtctaccaggctgcattccta
gatccccacactgcctccgagctcacgcttgacgaaattgtggctctctgcgacgatcta
attgaggcacacggaaactggctgccagaatttcattga

DBGET integrated database retrieval system