KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0827Help
Entry
Aaci_0827         CDS       T00985                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00010  Glycolysis / Gluconeogenesis
aac00020  Citrate cycle (TCA cycle)
aac00620  Pyruvate metabolism
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
aac01130  Biosynthesis of antibiotics
aac01200  Carbon metabolism
Module
aac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aaci_0827
   00020 Citrate cycle (TCA cycle)
    Aaci_0827
   00620 Pyruvate metabolism
    Aaci_0827
Enzymes [BR:aac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Aaci_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 RnfC_N PTS_EIIA_1 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACV57869
UniProt: C8WUA6
Position
897224..898540
Genome map
AA seq 438 aa AA seqDB search
MEFKLADIGEGIHEGEILRWLVKEGDQVEQDAPLVEVQTDKVTAELPSPVAGVIERIMAR
EGQVVPVGTVLAVIREAGAKAAAAASGAPGAQASLQEKPAAQAHSEAQPGREAAAPQASG
AAHRGGRRRALATPHVRALARKLGVDIDEIDGTGPVGRVTEEDVRRFAEGGREPAVEPAR
AHAEHAAEAQPTAALRVATPAASGEPVEQVPLRGLRRRIAEHMVQAKRIIPHATHIDEVE
MDGIEALRERLRPYAEARGVKLTSLAFFVKAVAIALKEFPYVNASVDEAQENVLLRRYYH
IGIAVDTEQGLIVPVVKHADEKSVFEIAREVSDLARRARENRLSLDEVTGSTFTISNAGA
LGGLYATPIINYPESAILGIHKMEPRPVVRNNEIVIRNIAHVSLSFDHRIIDGGMAIRFT
NRVRELLEEPDRLWAELR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaaactggcagacatcggcgagggcattcacgagggcgagattctgcgctgg
ttggtaaaggaaggcgaccaggtggagcaggatgcgccgctcgtggaggtgcagacggac
aaggtgacggcggagctgccgtctccagtggcgggcgtgatcgagcgcattatggcgcgc
gaggggcaggtggtgcccgtgggcacggtgctcgcggtcatccgagaggctggagccaaa
gcggcggctgcggcgtctggtgcgcccggcgcgcaggcatccctgcaggagaagcccgcg
gcgcaggcacacagtgaagcgcagcctgggcgcgaggctgccgcaccccaggcgagcgga
gccgcgcatagagggggcaggcggcgggcgcttgccacgccgcacgtgcgcgccttggct
cggaagctcggggtggacatcgacgagatcgacgggacgggcccggtcggccgggtaaca
gaggaggacgtgcgccgctttgcggagggcgggcgcgagcctgcggtggaaccggcccgg
gcacacgccgagcatgcggcggaagctcagccgacagccgcattgcgagtcgcaacgccc
gcggcgtctggcgagcccgtggaacaggtgccgctgcgtgggctcaggcggcggatcgcg
gaacacatggtgcaggccaagcgcatcatcccgcacgcgacgcacatcgacgaggtggag
atggatggcatcgaggcgctccgcgagcggctgcgtccgtacgccgaggcgcgcggcgtg
aaactcacgtcgctcgcgttcttcgtcaaggcggtggccatcgcgctcaaggagttcccg
tacgtcaacgcgtcggtggacgaggcgcaggagaatgtgcttctcaggcgctattatcac
atcggcatcgcggtcgacacggagcaggggctcatcgtgcccgtggtgaagcacgcggat
gagaagtcggtcttcgaaatcgcgcgcgaggtgtccgatctcgcccggcgggcgcgggag
aaccgcctgtcgctcgacgaggtgacgggcagcacgttcaccatctcgaacgccggcgcg
ctcggcgggctgtacgcgacgcccatcatcaactatcccgagtcggcgattctcgggatt
cacaagatggagccgcgccccgtggtgcgcaacaacgagattgtcatccgcaacattgcc
cacgtgtccctctcgttcgatcaccgcatcatcgacggcggcatggccatccgcttcacc
aaccgcgtgcgcgaactgttggaggagccggatcggctgtgggcggaacttcggtag

DBGET integrated database retrieval system