KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0920Help
Entry
Aaci_0920         CDS       T00985                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Aaci_0920
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aaci_0920
  Lipid metabolism
   00071 Fatty acid degradation
    Aaci_0920
  Amino acid metabolism
   00350 Tyrosine metabolism
    Aaci_0920
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Aaci_0920
   00626 Naphthalene degradation
    Aaci_0920
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Aaci_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
999477..1000610
Genome map
AA seq 377 aa AA seqDB search
MQTRAAVLMEMGARPPYASTRPLRLETLELEPPGPGEVLIRVRAAGLCHSDLSVIEGARP
RPMPMALGHEAAGEVVELGEGVTDLAPGDHVVCAFVPSCGHCAPCQEGRPALCEPGAEAN
GRGTLLSGARRLRLGGQPVHHHLGVSAFSDYAVVSRRSLVRIDPSLPFEHAALFGCAVMT
GVGAIVNTARVPVGASVGIVGLGGVGLAALLGAVASSARHIAAIDVNPEKLAFARELGAT
HTYDARDPGVIDKVRADSAGGLEYVFETAGSVAAMKTAFMVTRRGGTTVTTGLPDPRHEW
SVPQVLLAAEERTIRGSYVGSCIPSRDIPRFISLFQQGKLPVDRLVSDVIDLDHINEGFD
RLAAGEAVRIVVRMSGA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgcagacgcgagccgctgtcctcatggagatgggggcgaggccgccttatgcatccaca
aggccgcttcgcctggagacgctggaactggaaccgccagggccgggcgaggtcctcatc
cgggtgcgcgccgccggcctgtgtcattcggatctgtccgtcattgagggcgcccgcccg
cggccgatgccgatggcccttggccacgaggcggctggcgaggtggtggagctcggcgaa
ggagtgacggacctcgcgccgggcgatcacgtcgtctgcgcctttgtgccaagctgcggg
cactgcgccccctgtcaagagggccggccagcgctctgcgagccgggcgccgaggccaac
ggccgcggcacgctgctctccggcgcgcgcaggctgcgccttggcggacagcccgtccat
caccacctcggcgtgtcggccttcagcgactacgccgtcgtctcgcgccgctcgctggtg
agaatcgatccgtccctcccgttcgagcacgcggcgctgtttggctgcgcggtcatgacg
ggcgtcggcgcgatcgtcaacacggcgcgcgtccctgtaggcgcctcggtcggcatcgtc
ggcctcggcggggtgggactcgccgcgctgctcggcgcggtggcttcgtccgcccggcac
atcgcggccatcgacgtgaaccccgagaaactggcgttcgcgcgcgaactcggcgcaacg
cacacgtacgacgcgcgcgatcccggcgtgattgacaaggtgcgcgcggattcggcgggc
ggcttggagtacgtgttcgagacggcgggctccgtcgcggccatgaagacggcgttcatg
gtgacgcggcgcggcggcacgaccgtgaccacagggctgccggatcctcggcacgagtgg
agcgtgccccaggtgctgcttgcggccgaggagcgcaccattcggggctcgtacgtcgga
agctgcatcccgtcccgcgacatcccgcgcttcatttccttgtttcagcaagggaagctc
cctgtcgaccggctcgtgtcggacgtgatcgatctcgaccacatcaacgagggcttcgac
cgcctggctgcgggtgaggcggtgcgcatcgtggtgcgaatgagtggtgcctaa

DBGET integrated database retrieval system