KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0925Help
Entry
Aaci_0925         CDS       T00985                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aaci_0925
  Amino acid metabolism
   00340 Histidine metabolism
    Aaci_0925
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Aaci_0925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1003993..1005273
Genome map
AA seq 426 aa AA seqDB search
MRLDRVDVIEQASFNWRRTTGRDADVWEKVERIVEEVRVGGDDALRRLTRALDGVDAPLR
VPPEAMEAAFRALRAEVREALARAAERIRRFHEAQLPNDIVIRGEDGETLEMLWRPLHRV
GVYAPGGRAAYPSTVLMDVIPAQVAGVRSIALVSPPGPDGLPHPAVLAAAHLVGVEEMYA
VGGAQAVAALAYGTETIARVDKIVGPGNVYVATAKRMVMGDVGIDSIAGPTEVVVVADET
ANPAYVAADLLAQAEHDVEAGAVCLSPSRELLENVHAEIVRQLAALPRRDIAREALERHG
ALVHVKSLDDAVVLVNDMAPEHVEVVTENPRRVLNGLRTAGAVFLGPYTPEPVGDYFAGT
NHVLPTHGSARFSSGLGTLDFMRRMTAATYTAETIARHAPYIEALAEAESLTAHREAVRI
RREELR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttgatcgggtcgacgtgatcgaacaagcttcgttcaactggcggcgaacgacc
ggccgcgacgcggacgtgtgggagaaagtggagcgtatcgtcgaagaagtgcgcgtggga
ggcgacgacgcgctgaggcggctgacgagggccttggacggcgtggacgcgcccctgcgc
gtgccgccggaggcgatggaggccgcgtttcgcgcgctgcgcgccgaggtgcgggaggcg
ctcgcccgcgcggcggagcgcattcgccgctttcacgaggcgcagctgccgaacgatatc
gtcatccgcggtgaggacggcgagacgctcgagatgctgtggcgcccgctccatcgcgtc
ggcgtgtacgcgccaggcggccgagcggcctacccatcgaccgtgctgatggacgtcatc
cccgcgcaggtggcgggcgtccgctccatcgcgctggtgtcgccgccggggccggacggc
ctgcctcacccggcggtcctggccgcggcgcacctcgtcggggtcgaggagatgtacgcg
gtcggcggagcccaggcggtggcggcgctcgcgtatggcaccgagaccatcgccagagtg
gacaagatcgtcgggccggggaacgtgtacgtggcgacggcgaagcggatggtgatgggc
gacgtcgggatcgacagcatcgccgggccgaccgaggtggtggtggtggcggacgagacg
gcgaatccggcgtatgtggcggccgatctgctcgcccaggcggagcacgatgtggaggcg
ggggccgtgtgcctgagcccgtctcgcgagttgctcgagaacgtgcacgccgaaatcgtg
cgacagttggcggcgttgccgcggagggacatcgcgcgcgaggcgctggagcgccacggg
gcgctcgtccacgtgaaaagtctcgacgacgcggtcgttctcgtcaacgacatggcgccg
gagcacgtggaggtggtgacggagaacccgcggcgcgtgctaaacggccttcgcaccgca
ggagcggtgtttctcggcccatacacgccggaacccgtgggcgactacttcgccgggacc
aatcacgtgctgccgacgcacggcagcgcgcggttctcgagcgggctcgggacgctcgat
ttcatgcggcgcatgacggccgccacgtacacggcggagacgatcgcccgccacgcgccg
tacatcgaagcgctggcggaggccgaatcgctcacggcgcaccgggaagcggtgcgaatc
cgcagggaggagttgcgatga

DBGET integrated database retrieval system