KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_0977Help
Entry
Aaci_0977         CDS       T00985                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Aaci_0977
Enzymes [BR:aac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Aaci_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1050818..1051441
Genome map
AA seq 207 aa AA seqDB search
MATSRVDSERAHASLHVDKPMDTARIEQAVRMILEAIGEDPDREGLVDTPARVARMYQEI
FSGLHRDPQEELSARFHVEHGEIVLVRDIPFYSMCEHHLLPFFGTAHVAYLPHNNVVTGL
SKLARLVDVVAKKPQVQERMTNEIADALSEALQAEGVLVVIDAEHLCMSMRGIRKPGSRT
TTIAARGKYDEDARLREEVLHLIRLGV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacatctcgcgtggactcggagcgcgcgcacgcgtctttgcacgtggacaagccg
atggatacggcgcgaattgaacaggcggtccgcatgatcctggaggccatcggagaagac
ccggatcgggagggactggtggacacgcccgcccgggtggcgagaatgtaccaggagatc
ttttctgggctccatcgagacccccaggaggagttgtcggctcgcttccacgtcgaacac
ggcgaaatcgtgttggtgcgcgacatccccttttactcgatgtgcgagcaccacctgctt
ccgtttttcggaacggcgcacgtggcctatcttccgcacaacaacgtcgtgacggggctg
tccaagctcgcgcggctcgtggacgtcgtggccaagaagccccaagtgcaggagcgcatg
acgaacgagatcgcggacgccttgtcggaggcgctccaagcggaaggcgtgctggtcgtg
atcgacgcggaacacctgtgcatgagcatgcgcggcattcgcaagccaggcagtcgcacc
acgaccattgccgcgcgcggcaagtacgacgaggacgcgcgactgcgtgaagaggtcctg
catctcatccgcctcggcgtgtga

DBGET integrated database retrieval system