KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1254Help
Entry
Aaci_1254         CDS       T00985                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00010  Glycolysis / Gluconeogenesis
aac00620  Pyruvate metabolism
aac00640  Propanoate metabolism
aac00680  Methane metabolism
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
aac01130  Biosynthesis of antibiotics
aac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aaci_1254
   00620 Pyruvate metabolism
    Aaci_1254
   00640 Propanoate metabolism
    Aaci_1254
  Energy metabolism
   00680 Methane metabolism
    Aaci_1254
Enzymes [BR:aac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Aaci_1254
Lipid biosynthesis proteins [BR:aac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Aaci_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACV58283
UniProt: C8WW11
Position
complement(1307030..1308979)
Genome map
AA seq 649 aa AA seqDB search
MTPNDLDALLRETRTFAPSEEFRRQANYKDESIYEEAARDPEGYWAKQAEHITWFHEFES
VCRWDPPHAQWFIGGKLNAAYNCVDRHTLTHRKNKAAIIWEGEPGDSRVLTYDMLRREVD
KAAHMLTQLGVKKGDRVTIYLPMVPELPIAMLACAKIGAMHSVVFGGFSAQALKDRILDA
GSKLLITADGGWRRGKVIPLKQNADEAVVGTPIEKVVVVQRIGEAAQAAMDPARDVWWHE
AMQSAPTKPFPAEPMDAEDYLFLLYTSGTTGKPKGIVHSTGGYLVGVNTSMRTVFDLKDE
DVFFCTADIGWITGHTYIVYGPLSAGATVVMYEGSPDYPDRDRYWAIVEKYGATILYTAP
TSIRMFMKWGPQYVEKHDLSTLRLLGSVGEPINPEAWMWYHKYVGQERCPIVDTWWQTET
GCAMIAPLPGIITTKPGSATKPVPGISVDILDDDGNPVPPGHGGNLVITKPWPSMLRTVW
GDDERFRKTYFEKFEGIYLPGDGAYRDQDGYYWIVGRLDDVINVSGHRIGTAEVESALVA
HPAVAEAAVIGRAHEVKGQAITAFVILKEGHTGSDDLVSELKQFVVEQIGAMARPEEIIF
TADLPKTRSGKIMRRLLRDIAEGRVVGDTTTLADPAVVEQLKSQYKDQE
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaccccgaatgatctcgacgcactactccgtgaaacccgcacctttgccccgtccgaa
gaatttcgccgccaagcgaattacaaggatgaaagcatttacgaggaagctgctcgtgat
ccagagggttactgggcgaaacaagccgaacatattacttggttccatgaatttgaaagc
gtttgcaggtgggatccgccgcacgcgcaatggttcatcggcggcaagctgaacgccgcg
tataactgcgtggaccgtcacaccctcactcaccgcaagaataaggcggccatcatctgg
gaaggcgagccaggcgacagccgcgtcctcacgtacgacatgttgcgccgcgaagtcgat
aaggccgcacacatgctcacccagcttggggtcaaaaagggcgatcgcgtcaccatctac
ctgcccatggtgcccgagctccccattgcgatgctcgcgtgcgccaaaatcggcgccatg
cattccgtcgtgttcggcggattttccgcgcaggcgctgaaggatcgcatcctggacgcc
ggcagcaagctgctcatcacggcggacggaggctggcgccgcggcaaggtcattccgctc
aagcagaacgcggacgaagccgtcgtgggaacgcccatcgagaaggttgtggtcgtccag
cggatcggcgaagcggctcaggcagccatggatccggcgcgagacgtctggtggcacgaa
gccatgcagagcgcgccgaccaagcccttcccggctgagcccatggacgcggaagactac
ctgttcctgctctacacgtctggcaccacgggcaagccgaagggcattgtccacagcacg
ggcggatacctggtgggcgtcaacacgtccatgcggaccgtgttcgatctgaaggacgaa
gacgtgttcttctgcacggcggacatcggctggatcaccggccacacgtacatcgtgtac
ggcccgctgtcggccggcgcgacggtcgtcatgtacgagggatcgcccgattatcccgat
cgcgaccggtactgggccatcgtcgagaagtacggcgcgaccatcctgtacaccgcgccg
acatccatccgcatgttcatgaaatggggtccccagtacgtcgaaaagcacgatctcagc
acgctccggctgctcggatctgtcggcgagcccattaacccggaggcgtggatgtggtac
cacaagtacgtcggccaggagcggtgccccatcgtggacacctggtggcagacggaaacc
ggttgcgcgatgatcgcgcctctgccaggcattatcaccaccaagccgggttctgccacc
aagcccgtgcccggcatctccgtcgatatccttgacgacgacggcaatccggtgccgccg
gggcatggcggaaatctcgtcatcaccaagccctggccgtccatgctgcgcacggtgtgg
ggcgatgacgagcgcttccgcaagacgtacttcgagaagttcgagggcatctacctgcct
ggggacggcgcgtaccgagatcaggatggctactactggattgtcggacggctggacgac
gtgatcaacgtgtcgggccaccgcattggcactgcggaagtggagagcgcgctggtggct
catcccgctgtcgccgaggcggccgtgatcgggcgcgcccacgaagtcaaggggcaggcc
atcaccgcgtttgtcatcctcaaagagggccacaccggttcggacgatctcgtctcggaa
ctgaagcaattcgtcgtcgagcaaatcggcgccatggcgcggccggaggagatcatcttc
acggccgatctgcccaagacgcgcagcggcaagattatgcgccgcctgttgcgcgacatc
gcggaaggccgtgtggtcggcgacaccaccaccctggccgatccggccgtcgtggagcaa
ctgaaatcgcagtacaaggatcaggaatga

DBGET integrated database retrieval system