KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1305Help
Entry
Aaci_1305         CDS       T00985                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aac00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aac00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1353311..1354243
Genome map
AA seq 310 aa AA seqDB search
MRGAVFHALTVNQFDVPLVWELMERAEWLRGLDREEARTRLQGKIVATLFYEPSTRTRLS
FESAVLRLGGSVVGAENARESSSSKKGETLEDVFRVVGCYADAIVIRHHDQHELDRAARF
SPVPIVNAGAGSGEHPTQALLDVYTIWRELGRIEHLTVAVMGDLKYGRTVHSLLRLLAKF
PGVRVRLFHPAPLGLPDDLARELAASGLALERAPDLASAIRGADVVYQTRIQFERLAGEV
DPNAASLYALTKDHLALLPDHARILHPLPRVGEIAPEVDDDVRAAYFRQVENGLYMRMAL
LDAMLGGERR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggtgcggtgtttcacgcgttgaccgtgaaccagttcgatgtgccactcgtctgg
gagctgatggagcgcgccgagtggcttcgcggcttggaccgggaagaggctcggacgcga
ctccagggcaagattgtcgcgaccctcttctacgaaccgtccacgcgcacgcggctgtcg
tttgaatccgcggtcctccggctcggcggcagcgtcgtgggggccgagaacgcgcgcgag
tcgtcctcgtccaagaagggcgagacgcttgaggacgtgttccgcgtcgtgggctgctac
gccgacgccatcgtcattcgccatcacgatcagcacgagctcgaccgggccgcgcgcttc
tcgcccgtgcccatcgtgaatgccggtgccggcagcggggagcacccgacgcaggcgctg
ctcgacgtgtacaccatctggcgcgagctcggccggatcgaacatctcacggtcgcggtg
atgggcgatctcaagtacggccgcacggtccactccctgcttcggcttttggcgaaattc
cccggcgtgcgggtgcgcctctttcacccggcgccgctcggcttaccggacgatctcgcc
cgcgaactcgcagcctcgggcctcgcgctcgaacgagcgccggatctcgcgtcggccatc
cgcggcgcggacgtggtctatcagacgcgcattcagttcgagcggctggcaggcgaggtc
gatccgaacgccgccagcctgtacgccctcaccaaggaccacctggcgctcttgcccgat
cacgcgcggatcctgcatccgctccctcgcgtcggggaaatcgcgcctgaggtggatgac
gatgtccgcgcggcgtacttccgacaggtggaaaatggactctacatgcgcatggcgctc
ctcgatgccatgctgggaggagagcggcgatga

DBGET integrated database retrieval system