KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1330Help
Entry
Aaci_1330         CDS       T00985                                 

Definition
ATP-dependent DNA helicase RecG
Orthology
K03655  
ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aac03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1383843..1385879
Genome map
AA seq 678 aa AA seqDB search
MSLRSLSVRALPGVGPQKERALEALGIRTVDDLLHTYPFRYDERAEKPFSEWRDGDRVTA
RAVVEGPVQVRWRGSKSIMTARVRVDGQHPVVCLWFSQHYLRSKLSDGRFIVVTGKWNEA
LRRLVASETSFDAGTQAPSLVPVYRASKELSTKAIHQLILKALEQYAEEIQESLPYALVR
KYRLWTHRDALFGMHRPKSLEDVRQARRRLVFEEFLLFQIQLQWLRAKREEPAGRAQPVP
SDALTAFEALLPGPMTNAQRRACEDILRDLQRPVPMTRLIQGDVGSGKTWVALFACFAVH
LARGQSALMAPTEILAEQHARLAHELLGSAGVRVELLTGSVTGRERDRVLAGLASGDVSL
AVGTHALLSEGVEFRDLALLVTDEQHRFGVAQRARLREKGRAPDVLMLSATPIPRTLALA
IYGDMDVSILNELPKGRKPVQTIAVPSKDDETVLRLIRRELARGHQAYIVAPAIEASERD
DVASVTELYERVREHLAGFRVELLHGRMPSADKERMMRAFRDGDIHALVATTVIEVGIDV
PNATVMAIYGAERFGLAQLHQLRGRVGRGPHPSYCLLIHDASSEAARARIETMLQTNDGF
EIAERDLELRGPGELFGLRQSGLPEFALGDLARDYRIMEVAREEALALLRRDDFWYAPWA
EGLRNALKEAMDKVSYRD
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgctcagatcgctgtccgtgcgcgcgctgccgggcgtgggtccgcagaaggagcga
gcactcgaagcgctcggcattcgaacggtcgacgacttgctgcacacgtatccgtttcga
tatgacgagcgagcggagaagccattttccgaatggcgcgatggcgatcgcgtcacggcg
cgggctgtcgtcgaaggacctgtgcaagtcaggtggcgcggttccaagtccatcatgacg
gcgcgcgtgcgcgtggacggccaacatccggtcgtctgcctctggttttcgcaacattac
cttcgctccaagctatccgacgggcggttcatcgtggtaacaggcaaatggaatgaagct
ctgcgccgcctggtcgccagcgagacatcgtttgacgccgggacacaggcgccctcgttg
gtaccggtataccgcgcgagcaaagaactctcgacgaaggccatccaccaactcatcctg
aaggcgttggagcaatacgcggaagagatccaggagtcgctgccgtacgcgctcgtgcgc
aagtatcggctttggacgcatcgagatgcgctcttcgggatgcatcggcccaaatcgctc
gaggacgtccgtcaggcccggcggcggctggtgttcgaggagtttctcttgtttcaaatt
cagctccagtggcttcgcgcaaagcgcgaggagcccgcggggcgcgcgcagcccgtgccg
agtgatgcgctgacggcgttcgaggccctcctgcccggtccgatgacgaacgcgcagcgg
cgcgcgtgcgaggacatcctgcgggatcttcagcgccccgtgcccatgacgcgcctgatt
cagggggacgtcggatcgggcaagacgtgggtggccctttttgcgtgctttgcggtccac
ctcgcgcgcggacagtccgcgctcatggcgcccaccgaaatcctcgccgagcagcacgcg
aggctcgcgcacgagctgctcggctctgccggcgttcgcgtcgagcttttgacgggttcg
gtgacaggacgcgagcgcgatcgcgtgctggcgggcctcgcctccggggacgtgtcgctt
gccgtcggcacgcacgcgcttctgtccgagggtgtcgagtttcgcgatctcgccctgctc
gtcaccgatgagcagcatcgcttcggcgtcgcgcagcgcgcgaggctgcgtgagaagggc
cgcgccccggacgtgctcatgctgtcggcgacgccgattccgcggacgcttgcgctcgcc
atctacggcgacatggacgtgtccatcctgaacgagttgccgaagggccgaaagcccgtt
cagaccatcgccgtgccgtcgaaagacgacgagaccgttcttcgcctcatccgcagagag
ttggcgcggggacaccaggcctacatcgtcgcgccggccatcgaggcgtcggagcgagac
gacgtggcgtccgtgacggagctttatgagcgcgtgcgcgaacacctggcgggatttcgc
gtcgaactcctgcacgggcggatgccaagcgccgacaaggagcgcatgatgcgcgcgttc
cgcgacggcgacatccacgcgctcgtcgcgacgaccgtgatcgaggtcggcatcgacgtg
cccaatgccaccgtgatggccatctatggcgcggagcggttcggtttggcgcaattgcat
cagcttcgcgggcgagtcggacgagggccgcatccgagctactgcctgctcattcacgac
gcatcgtccgaggcggcgcgcgcgcgaatcgagaccatgctgcagacgaacgacgggttt
gagatcgcggagcgggacctggaattgcgcgggcctggggagttgttcggcctgaggcag
agcggtcttcccgagttcgcgttgggcgatctcgcccgcgattatcggatcatggaggtc
gcaagggaagaggcgctggcgctccttcggcgggacgatttttggtacgctccgtgggcc
gagggtctgcgcaacgcgctgaaggaggccatggacaaggtttcgtatcgagactga

DBGET integrated database retrieval system