KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1375Help
Entry
Aaci_1375         CDS       T00985                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aaci_1375
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aaci_1375
   00640 Propanoate metabolism
    Aaci_1375
   00660 C5-Branched dibasic acid metabolism
    Aaci_1375
Enzymes [BR:aac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Aaci_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1429741..1430895
Genome map
AA seq 384 aa AA seqDB search
MNIHEYQAKAILAEFGVKVPRGKVAFTVEEAVEAAKELGGKAVVKAQIHAGGRGKAGGVK
VSKSLEEVEANARELLGKRLVTHQTGPQGRIVRRLLIEELTNIQKEYYIGLVLDRSQGRL
VMMASQEGGVEIEEVAAKHPEKIFRETIDPLTGLTPFQANNLAYKLELPQDAVKKAAQFM
MALYNAYVAKDCSIAEINPLVLTAEGDIIALDAKLNFDDNALYRHPEIVSLRDEDEEDPK
EIEASKYGLSYIALDGNIGCMVNGAGLAMATMDTIKYYGGEPANFLDVGGGASEEKVTAA
FKIILSDPKVKGILVNIFGGIMKCDVIANGVVAAAKQVGLDKPLVVRLEGTNVEAGKKIL
NESGLKLVAADSLADAAQKIVALV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatccacgagtatcaagcgaaggccattctggctgaattcggcgtcaaagtcccg
cgcggcaaagtggctttcacggttgaagaggctgtggaagcggcaaaagaacttggtggc
aaggctgtagtaaaggctcaaattcatgcaggcgggcgcggcaaggcgggtggcgtcaaa
gtctcgaagtccctggaggaggtcgaggcgaacgcccgcgagcttctcggcaagcggctc
gtcacgcaccaaacgggaccgcagggccgaattgtacggcgactgctcatcgaagagctc
acgaatatccagaaggagtactacataggcctcgttcttgaccgatcccagggacgcttg
gtgatgatggcctcccaggagggcggcgtcgagatcgaagaggtagctgcaaaacacccg
gaaaagattttccgtgagaccattgatccactgacggggctcacgccgttccaggcgaac
aacctcgcgtacaagcttgagctgcctcaggatgcggtgaaaaaggccgctcaattcatg
atggcgctttacaacgcgtacgtcgcgaaggattgctccatcgcggagatcaatccgctg
gtactgacagcggaaggcgacatcatcgccctggatgcgaagctcaacttcgacgacaat
gctttgtaccggcatcccgagatcgtcagcctgcgcgacgaggacgaagaagatccgaag
gaaatcgaagcctcgaaatacggtttgagttacatcgcgctggacggcaacattggatgc
atggtgaatggtgcgggcctggccatggccacgatggacaccatcaagtattacggcgga
gagcctgcgaacttcctggacgtcggtggaggcgccagcgaagagaaagtgacggcggcg
ttcaaaatcatcctgtcggatcctaaagtgaaaggtatcctcgtcaacatcttcggcggc
atcatgaagtgcgacgtgatcgcaaacggcgtggtcgcagcggccaagcaggtcggcctg
gacaagccgctcgtggtgcgcctcgagggcacgaacgtcgaagccggaaagaaaatcttg
aacgaatcgggtctgaagttggtggcggctgattcgctcgctgacgctgcccaaaagatc
gtggcgctggtctga

DBGET integrated database retrieval system