KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1375Help
Entry
Aaci_1375         CDS       T00985                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00020  Citrate cycle (TCA cycle)
aac00640  Propanoate metabolism
aac00660  C5-Branched dibasic acid metabolism
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
aac01130  Biosynthesis of antibiotics
aac01200  Carbon metabolism
Module
aac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aaci_1375
   00640 Propanoate metabolism
    Aaci_1375
   00660 C5-Branched dibasic acid metabolism
    Aaci_1375
Enzymes [BR:aac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Aaci_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A Phage_tail_S ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACV58402
UniProt: C8WWD1
Position
1429741..1430895
Genome map
AA seq 384 aa AA seqDB search
MNIHEYQAKAILAEFGVKVPRGKVAFTVEEAVEAAKELGGKAVVKAQIHAGGRGKAGGVK
VSKSLEEVEANARELLGKRLVTHQTGPQGRIVRRLLIEELTNIQKEYYIGLVLDRSQGRL
VMMASQEGGVEIEEVAAKHPEKIFRETIDPLTGLTPFQANNLAYKLELPQDAVKKAAQFM
MALYNAYVAKDCSIAEINPLVLTAEGDIIALDAKLNFDDNALYRHPEIVSLRDEDEEDPK
EIEASKYGLSYIALDGNIGCMVNGAGLAMATMDTIKYYGGEPANFLDVGGGASEEKVTAA
FKIILSDPKVKGILVNIFGGIMKCDVIANGVVAAAKQVGLDKPLVVRLEGTNVEAGKKIL
NESGLKLVAADSLADAAQKIVALV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatccacgagtatcaagcgaaggccattctggctgaattcggcgtcaaagtcccg
cgcggcaaagtggctttcacggttgaagaggctgtggaagcggcaaaagaacttggtggc
aaggctgtagtaaaggctcaaattcatgcaggcgggcgcggcaaggcgggtggcgtcaaa
gtctcgaagtccctggaggaggtcgaggcgaacgcccgcgagcttctcggcaagcggctc
gtcacgcaccaaacgggaccgcagggccgaattgtacggcgactgctcatcgaagagctc
acgaatatccagaaggagtactacataggcctcgttcttgaccgatcccagggacgcttg
gtgatgatggcctcccaggagggcggcgtcgagatcgaagaggtagctgcaaaacacccg
gaaaagattttccgtgagaccattgatccactgacggggctcacgccgttccaggcgaac
aacctcgcgtacaagcttgagctgcctcaggatgcggtgaaaaaggccgctcaattcatg
atggcgctttacaacgcgtacgtcgcgaaggattgctccatcgcggagatcaatccgctg
gtactgacagcggaaggcgacatcatcgccctggatgcgaagctcaacttcgacgacaat
gctttgtaccggcatcccgagatcgtcagcctgcgcgacgaggacgaagaagatccgaag
gaaatcgaagcctcgaaatacggtttgagttacatcgcgctggacggcaacattggatgc
atggtgaatggtgcgggcctggccatggccacgatggacaccatcaagtattacggcgga
gagcctgcgaacttcctggacgtcggtggaggcgccagcgaagagaaagtgacggcggcg
ttcaaaatcatcctgtcggatcctaaagtgaaaggtatcctcgtcaacatcttcggcggc
atcatgaagtgcgacgtgatcgcaaacggcgtggtcgcagcggccaagcaggtcggcctg
gacaagccgctcgtggtgcgcctcgagggcacgaacgtcgaagccggaaagaaaatcttg
aacgaatcgggtctgaagttggtggcggctgattcgctcgctgacgctgcccaaaagatc
gtggcgctggtctga

DBGET integrated database retrieval system