KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1456Help
Entry
Aaci_1456         CDS       T00985                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aaci_1456
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aaci_1456
   00620 Pyruvate metabolism
    Aaci_1456
   00640 Propanoate metabolism
    Aaci_1456
  Energy metabolism
   00680 Methane metabolism
    Aaci_1456
Enzymes [BR:aac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Aaci_1456
Lipid biosynthesis proteins [BR:aac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Aaci_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1509242..1510888
Genome map
AA seq 548 aa AA seqDB search
MEPSQTAAFAELLAPDVFNIASAILDRDESRRALVWRSEAGAKRTLTYGELRRESLRLAQ
SLHDLGLRKGDRVLVLMPRRPETYAVYLAILSLGAVVLPGSELLMPNDIAYRLRHAEAKG
VIAHAALAERAEAAIAEAPWVQLRVVVEGPREGWLAYDDLVRGAPREWDVVPTRRDDLAF
LSYTSGTTGYPKGVMHVHGWAYAHWHIAAKRWLGIEPDDVVWATAGPGWAKWIWSPFVAT
LMSGATGFHYGGRFDAETFLRLIDDEAVNVLCATPTEYRMMAKVDGLDRFRLSSLRQAVS
AGEPLNREVIDTFRRHFQVTVRDGYGQTENTLLVATCVDTEVRPGSMGLPTVEGAVDIVD
DEGRPLPPGQVGDIAVRRDFPALFRGYYKDDERTEAQFRGAWYITGDRAEKDEDGYLWFS
GRADDIIISAGYTIGPFEVEDALVKHPLVRECAAVSSPDEVRGAIVKAFVVLKDANLHRE
LASDGERREALVRELQEHVKRITAPYKYPRAIEFVEDLPKTTSGKIRRVELREREWKRHR
KLNEEQGG
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggagccatcccaaaccgccgcatttgcggagcttctggcgccggacgtgttcaacatc
gcgagcgccattctggaccgggacgaatcgaggcgcgcgctcgtgtggcgctcggaggcc
ggggcgaagcggaccctgacgtacggcgagcttcgccgcgagtcccttcgcctggcgcaa
tctcttcacgatctcggccttcgaaaaggcgaccgggtcctggtgttgatgccgcgccgc
ccggagacctacgccgtgtatctcgccatcctctcgctcggcgccgtggttctgcccgga
tcggagttactcatgccgaacgacatcgcctatcgcctgagacacgcggaggcgaagggc
gtgatcgcccacgcggcgctcgcggagcgggccgaggcggccatcgccgaggcgccgtgg
gtgcagttgcgcgtcgtggtcgagggcccgcgcgaaggctggctggcgtatgacgacctc
gtgcgcggcgcccccagggagtgggacgtggttccgacgcgtcgggacgatctcgccttc
ctgtcgtacacctccgggacgacgggctaccccaagggtgtgatgcatgtccacggctgg
gcgtacgcgcactggcacatcgccgcgaagcgctggctcggcattgagcctgacgacgtg
gtgtgggccaccgccgggcccggatgggcgaagtggatctggagccccttcgtcgccacg
ctcatgtcgggcgccacaggcttccactacggtggccgatttgacgcggagacgtttctt
cggctcatcgacgacgaagcggtcaatgtgctctgcgcgacgcccacggaataccggatg
atggccaaggtggacggcctcgatcggtttcgcctctcgtcgctgcgccaggcggtgagc
gcgggcgagcctcttaaccgagaagtcattgacacgttccgccgccattttcaggtcacc
gtgcgcgacggctacgggcagacggagaacacgcttctcgttgcgacgtgcgtcgatacg
gaggtgcgccccggttcgatggggctgccgacggtcgaaggggccgtcgacattgtcgac
gacgagggcaggccacttcctccgggccaggtgggggacatcgcggtcaggcgagacttc
ccggccctcttccggggttactacaaggacgacgagcggaccgaggctcagtttcggggc
gcgtggtacatcacgggcgatcgcgccgagaaagacgaggacggatatctgtggttcagc
ggccgcgcggacgacatcatcatcagcgctggatacaccatcgggccgtttgaggtcgag
gacgcgctcgtgaaacatccgctggtgcgcgagtgcgcagcggtgtcgagcccggatgag
gtgcggggcgcaattgtgaaggcgttcgtcgtcctcaaggatgccaacttgcaccgagag
ctggcatccgacggcgagcgacgcgaggcgctggtgcgagaactgcaggagcacgtgaag
cggatcaccgcgccctacaagtatccgcgcgcaattgagtttgtggaggatttgccgaag
acgacgtcggggaagattcgccgcgtcgagctcagggagcgcgagtggaagcggcaccgc
aagctgaacgaggagcagggagggtga

DBGET integrated database retrieval system