KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1620Help
Entry
Aaci_1620         CDS       T00985                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Aaci_1620
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aaci_1620
   00650 Butanoate metabolism
    Aaci_1620
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Aaci_1620
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Aaci_1620
   00622 Xylene degradation
    Aaci_1620
   00621 Dioxin degradation
    Aaci_1620
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Aaci_1620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1691149..1692048)
Genome map
AA seq 299 aa AA seqDB search
MKKLSAAIVGSGNIGTDLMIKLKRSPWIEPRWMIGIDPESDGLRRAREMGLETSADGLKA
VLEQGVRPDIVFDATSAKAHVRHAKLLREAGIQAVDLTPAARGPYVIAAVNLEEHLDSPN
VNMVTCGGQATVPMVYAVSRVVGVRYAEIVATIASKSAGPGTRANIDEFTQTTARALEAI
GGAKRGKAIIILNPAEPPILMRDTIYCLMEDASPTTQAKVLESIEQMVRHVQTFVPGYRL
NREPIFQDDLVSISIEVEGLGDYLPVYAGNLDIMTAAAVKFGEEYARHKMQVASAEEAR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagctcagtgccgcgatcgtcgggtccggaaacatcgggacggatctcatgatc
aagctgaagcgaagcccgtggattgaaccgcgctggatgatcggcatcgacccggaatcg
gatggccttcggcgcgcgcgcgagatggggcttgagacgtcggccgacggactcaaggcg
gtcctcgaacaaggggtgcgcccggacatcgtctttgacgcgacgagcgcgaaggcgcac
gtgcgccatgccaaactgcttcgcgaagcaggcatccaggcggtcgacttgacgccggca
gcgcgcgggccgtacgtcatcgcggcggtcaacctggaggagcacctcgactcgccgaac
gttaacatggtcacctgcggcggccaggccaccgtgccgatggtgtacgccgtcagccgg
gtggtcggggtgcgttacgcggagattgtcgccaccatcgccagcaagagcgcgggcccc
ggcacgcgggcgaacatcgacgagttcacccagacgacggcgcgcgcgctggaggccatc
ggaggcgcaaagcgagggaaggccatcatcatcctcaacccggcggaaccccccatcctc
atgcgcgacaccatctactgcttgatggaagacgcgagcccgaccacccaggcgaaggtg
ctcgagtccatcgaacagatggtgcgccacgtgcagacattcgtccctgggtatcggttg
aaccgcgagcccatcttccaggacgatctcgtcagcatctccatcgaggtcgagggcctc
ggcgattacctgccggtgtacgcggggaacctcgacatcatgaccgcggcggcagtgaag
tttggcgaagagtacgcgcgtcacaagatgcaggtggcgtcggcggaagaagcgaggtga

DBGET integrated database retrieval system