KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1667Help
Entry
Aaci_1667         CDS       T00985                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aaci_1667
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aaci_1667
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aaci_1667
Enzymes [BR:aac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Aaci_1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1739261..1740064)
Genome map
AA seq 267 aa AA seqDB search
MDRIREAFQAGHKLLIPFVVAGDPDYERSLDIACAILDAGADMLEIGFPYSDPLADGPVI
QAAAVRSLKQGTRLVDCLRLVRDIRARSPKPLVAFTYVNPLIQYGAERFFAELAAAGGDG
VIVPDVPLEEAGEVASAAEAHGIQFVPLVAPTSGEERVRAIVRAARGFVYCVSSLGVTGE
RQQVSRQVRELVDLVRKHTDLPACVGFGVSRPEHVREIAEFADGVIVGSAYVRRIGDAAD
EGRDPVEAVRSFTRELKQAALGAMHPH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaccgaattcgtgaggcctttcaagctgggcacaagcttctcattcccttcgtcgtc
gcgggcgatccggattacgagcgctctctcgacatcgcgtgcgccatcctggatgcgggc
gcggacatgcttgagatcggatttccgtattccgatccgctggccgacggcccagtcatc
caggcggccgcggtacgtagtctgaagcaaggcacgcgcctcgtggactgcctccgcttg
gtgcgcgacattcgggcgcgatcgccgaagccgctcgtcgcgttcacctacgtcaatccg
ctcattcagtacggcgcagagcggtttttcgcggagctcgcggcggctggcggcgacggg
gtgattgtcccggacgtgccgctcgaggaggcgggcgaggtggcgtcggcggccgaggcg
cacggcatccagttcgttcctcttgtggcgcccacgtcgggcgaggagcgggtgcgcgcg
attgtgcgagcggcgcgaggctttgtgtactgcgtctcgtccctcggcgtgacgggcgag
cgccagcaggtgtcgcggcaggtccgcgagcttgtcgatctcgtccgcaagcacacggac
ctgcccgcctgcgtgggatttggcgtgagccgccccgagcacgtgcgcgagatcgcggaa
ttcgcggacggcgtcattgtgggcagtgcctacgtgcggcgcattggggacgcggccgac
gagggacgcgatcccgttgaagcggtgcgctcgttcacccgagagctcaagcaagcggcg
ctgggggccatgcacccgcattga

DBGET integrated database retrieval system