KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1668Help
Entry
Aaci_1668         CDS       T00985                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aac01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aac00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aac00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1740048..1741262)
Genome map
AA seq 404 aa AA seqDB search
MSHYPYPDETGRYGAFGGRYVPETLMSALLQLEQDYLRLSRDESFQAELKYYLQQYAGRP
TPLYYAERLTKHLRGPKIYLKREDLNHTGAHKINNAIGQALLALRTGKRRVIAETGAGQH
GVATATVAARFGLECTVFMGEEDMRRQALNVFRMRMLGAEVVAATSGTRTLKDATNEAIR
HWVAHVDDTHYIIGSVVGPHPYPMIVRDFQRVIGDEAKAQILEQEGRLPSSVVACVGGGS
NAMGIFYPFIEDESVELIGCEAAGHGLETPYHAASIARGRPGVLHGAKTMLLQDEYGQVQ
PAHSISAGLDYPGIGPEHAHLAATGRATYVPVTDEEALEAFFLLSKLEGIIPALESAHAI
AYLMREAGRYGSDDVVIVCLSGRGDKDVEQVAAREGERQHGPNS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagtcattatccttatcctgatgaaacggggcgatatggcgcgtttggcgggcgttac
gtcccggagacgctcatgtcggccctcctgcagttggagcaagattacctgcgcctctcg
cgcgacgagtcgtttcaagcggaactcaagtattatttgcagcaatacgcgggcaggccg
acgccgctctattacgcggagcgcctgacgaaacacctgcgcgggccgaagatctacctg
aagcgcgaagacctgaatcacacaggcgctcacaagatcaacaacgccatcggccaagca
ctgctcgcgcttcggacgggcaagcggcgcgtgatcgccgagacgggcgcgggccagcac
ggggtggcgacggcgacggtggccgcgcggtttggcctggaatgcacagtgttcatgggc
gaagaggacatgcgcaggcaggcgctgaacgtctttcgcatgcggatgctcggcgcggaa
gtggtggccgcgacgtcggggacgaggacgctcaaagacgccacgaacgaggccattcgc
cactgggtggcgcacgtggacgacacccattacatcatcgggtcggtcgtggggcctcat
ccgtatcccatgatcgttcgcgattttcagcgcgtgattggggatgaggcaaaggctcag
atcctcgaacaggagggccgcctgccctcgagtgtggtggcgtgtgtcggcggcggctcg
aacgccatgggcatcttttatccgttcatcgaggacgaaagcgtggagctcatcggctgc
gaggcggctggacacgggctggagacgccctatcatgcggcgagcatcgcgcgcgggcgc
ccgggcgtgttgcacggggcaaagaccatgctgttgcaggacgaatacggccaggtccag
cccgcccattcgatctcggcgggactcgactatccgggcatcgggcctgaacacgcgcat
ctggcggcgacggggcgcgcaacgtacgtgccggtgacggacgaggaagccctcgaggcg
ttctttcttttgtcgaagctcgaaggcatcattccggcgctcgagagcgcgcacgccatc
gcgtacctgatgcgggaagcgggtcgatatggctcggacgacgtcgtgatcgtctgctta
tccggccgcggcgacaaagacgtcgagcaggtggccgctcgagagggggagcgacagcat
ggaccgaattcgtga

DBGET integrated database retrieval system