KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1670Help
Entry
Aaci_1670         CDS       T00985                                 

Definition
(RefSeq) Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aaci_1670
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aaci_1670
Enzymes [BR:aac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Aaci_1670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1741935..1742738)
Genome map
AA seq 267 aa AA seqDB search
MSTILDRILETKRREVEALRQRVHREGPFPERTEPFRSLAQTLRQAQRLGVIAEIKRKSP
SKGVFQASVDPAERARVYEQGGASAISVLTDETYFHGALEDLRAARSAVHLPILRKDFVI
DEIQVDEAVSAGADILLLIAAAMPADRLVELSRYARARGLEVLLEVHGEDEVEAALAAEP
TLIGINNRDLRTFEVDLATSERVLRRLPEGSLAIAESGIMGREDALRMASAGARGILVGE
LLMRHADLASVRAQVAELCVPLEAVAK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccatcttggaccgaattctcgaaaccaaacgccgcgaagtggaggcgctgcgg
cagcgcgtgcatcgtgaaggaccctttccggagcgaacggagccgtttcgttcgctggct
cagaccctgcgccaggctcaacgcctgggtgtcatcgccgagatcaagcgcaaaagcccg
tccaaaggcgtgtttcaggcgagcgtggatcccgccgagcgcgccagggtgtacgagcag
ggtggcgcttcggccatctccgtgttgacggacgagacgtatttccacggtgcgcttgag
gacttgcgtgcggcccgatcggccgttcaccttcccatcctccgtaaggatttcgtgatc
gacgagatccaggtggacgaggcggtttcggcaggggcggatatccttctgctcatcgcc
gccgccatgcccgcagatcggctggttgagctctccaggtacgcgcgagctcgggggctc
gaggtgctgctcgaagtgcacggcgaggacgaggtggaggccgccctggcggcagagccg
accttgattggcatcaacaatcgcgacctgcggaccttcgaggtggatctcgccacgtcg
gagcgggtcctgcggcgattgcccgaagggtccctcgccatcgccgagagcggcatcatg
ggccgagaggacgcccttcgcatggcgtctgcgggcgcgagaggcatcctggtcggcgag
ctcctgatgcgccacgcggatctcgcatccgtccgagcacaggtggcggagctttgcgtg
ccgcttgaggcggtggcgaagtga

DBGET integrated database retrieval system