KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1675Help
Entry
Aaci_1675         CDS       T00985                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aac00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1746653..1747636)
Genome map
AA seq 327 aa AA seqDB search
MRDWVMRLIDFVAPSGSEEAVVQSLLDHVREAADEIWVDALGNGIARKRGEGPHLMLAAH
VDEPGVMVIDIDDRGYLRVVSVGEVHARECVGQEVRFTNGAVGLVHADPAKQGDLDFDAL
VVDVGARSREDAERMAPIGTAGAVHVPAATWGESVVTGRALDNRLGCAVAAEVFRNLAAR
GLNVSVAFTAQNAVGARAAQAAAFQLEPRYALVIDGATADDVFNHQTVLSLGKGPVLKVM
DRGTVVPLEGKRAVEKAADRLNLLLQYEVSREAWSDTGAIQLARAGCVAVALGYPVRRAG
AFAMTADISDAERLVDLAVATVETLLG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagggactgggtgatgcggttgatcgacttcgtcgcgccgagcgggagcgaggaggcc
gtggtccaatcgctgttggatcacgtccgggaagcggcggacgaaatctgggtggacgcg
ctcggcaacgggatcgcgcgaaagcggggcgaggggcctcacctcatgttggccgcgcac
gtcgacgagccgggtgtcatggtcattgacatcgacgaccgcggctatctccgcgtggtc
tccgtcggagaggtgcacgcgcgcgagtgcgttggacaggaggtccgtttcacaaacggc
gcagtcggcctcgtccacgcagatccggcgaagcagggcgatctcgacttcgacgcgctc
gtggtcgacgtcggggcgcgatcgcgcgaagatgccgagcgcatggcgcccatcggcacg
gccggcgcggtgcacgttcccgctgcgacatggggggaaagcgtcgtgacgggccgagcc
ttggacaaccggctgggatgcgccgtcgccgcggaggtgttccgcaacctcgccgctcga
gggttgaacgtgagcgtcgcgttcacggcgcagaacgccgtcggggcgagggccgcgcag
gctgcggcgtttcagctggagccgcggtatgccctcgtgatcgacggggcgaccgcggac
gacgtgttcaaccatcagacggtcctttccttgggcaaggggcccgtcctgaaggtgatg
gaccgcgggaccgtggtgccgctcgagggcaagcgcgccgtggagaaggcggcggatcgg
ttgaaccttctccttcagtacgaggtgtcgcgggaagcctggagcgacacaggcgcgatt
caactcgccagggcggggtgtgtggcggtcgcgctcgggtatcccgtgcgccgcgcaggc
gcgttcgcgatgaccgcagacatctcggacgccgagcggctggtggacctcgccgtggcg
acggtggagacgctgttgggctga

DBGET integrated database retrieval system