KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_1677Help
Entry
Aaci_1677         CDS       T00985                                 

Definition
(GenBank) peptidase M42 family protein
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1748664..1749725)
Genome map
AA seq 353 aa AA seqDB search
MSKYVSVFKQLLEAHGGPGFEEDVRNLILPHLSEYATEMWTDALGNLIGLVPGVGEGRRP
RVLVSAHIDEIALVVTRIESGGFLRLAQAGGFDPRTLVGQEVVVHAQSGRVWGVIGAKPP
HLTPPSERSKAAKLEDLYVDLALPEEEVRARVRVGDRVTLRRSPVDLLNGRIAGKSVDNR
ASAAVLLEALALLKGMVHSADLYAVFTVQEEVGLRGARTAGFGLAPDIAIAVDVTFGAFP
GQAPDESFPLEGGVAISFGPNLHRRVFRRLVDCADRHRIPYQIELSQGPVGADANAFQIA
GPGLAAALIGPPIRYMHTSVETVAYDDIWQCARLLAHYLAEVDAAQVEELTCY
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaagtacgtgagcgtgttcaagcagttgctcgaagcgcacggcgggccaggcttc
gaggaggacgtgcgcaacctcattctccctcatctatcggaatacgcgacggagatgtgg
accgacgcgctcggcaacctcatcggcctcgtcccgggtgtgggagaagggcggcggccg
cgggtgctcgtgtccgcacacatcgacgaaattgcactggtcgtcacccgcatcgaatcg
ggcggatttctgcgtctcgcgcaggcggggggattcgatccgcggacgctcgtcggccaa
gaggtcgtggttcacgcccaaagcggccgggtctggggcgtcatcggggccaaaccgccg
cacctcacgcctccttccgagcggtcgaaagccgcgaaactcgaagatctgtacgtcgat
ctcgccctccctgaggaggaggtgcgcgcgcgcgtccgggtgggcgatcgcgtcacgctt
cgccgctcgcccgtcgatctgctcaacggccggatcgcgggcaaatcggtcgacaaccgg
gcgagtgcagccgttctgttggaggcgctcgccttgctgaagggcatggtgcacagcgcg
gatctctacgccgtgtttacggtgcaggaggaggtcggcctgcggggggccagaacggct
ggatttggcctggcgcccgacatcgccattgccgtggacgtcaccttcggggcgtttccc
gggcaggcgccggatgagtcgtttccgctcgaaggcggtgtcgccatctccttcggcccc
aacctccaccggcgggtgtttcggcgcctcgtggactgcgccgacaggcatcgcatcccg
tatcagatcgagctgtcgcaggggccggtgggcgcggacgccaacgcatttcaaattgcc
ggccccggcctcgcggcggcgctcatcggtccgccgattcggtacatgcacacgtcggtc
gaaaccgtcgcttacgacgacatttggcagtgcgcgcgactcctcgcccattacttggcg
gaggtcgacgccgcgcaggtggaggagttgacatgttactga

DBGET integrated database retrieval system