KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2091Help
Entry
Aaci_2091         CDS       T00985                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:aac00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2145327..2146739
Genome map
AA seq 470 aa AA seqDB search
MKRVAVVGGGITGLAACLRLLSSDANVQILLYEASDRLGGRVQTIREPDLGITVEAGPDS
MLARKPAAMRLIESLGMAEDVVSTRPEATETYIVRDGGLCPMPKGYLGIPFDPSCVRPPL
LTEAGLARALEEERLPLDLPEDDAALGAFLRARLGDEWVNYVGEPLMAGIYAGDIDQLSL
MATWPLLLDLIRNHGSLVAASRALMAPSSRRQPGSSRSAFITVRGGLSSVIERMVDRIER
SGRVEIRIGARVGAVTRRGAAYRFHIDTASGERFEEDVDGVVFAIPPQVAREIMSSVIDL
PDVETHYQSTATIVLVYARTAFGPDLARASGFLVPRPEGMAITATTWMSSKWPHVAPESL
AVIRAYVGRRHQDEALALSDDELARRAAEEVGRLTGAREHPVWLRVTRFSEAMPNYGLGH
LARVERAEAALRASCPAMAIAGAGYRGVGLPDCVEQGERAADQVLAAIRA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgtagcggtggtgggcggtggcatcacgggtctcgcggcttgcctgcgcctt
ttgtcctccgatgcaaacgtgcaaatccttctgtacgaggcgagcgataggcttggcggg
cgcgtgcagacgattcgcgagcccgatctcggcatcacggtggaagcgggcccggactcg
atgctcgcgcgaaagcccgcagcgatgcggctgattgagtcgttgggaatggcggaagac
gtcgtgtccacgcggccggaggcaaccgagacctacatcgtccgggacggcgggctctgt
cccatgccgaaagggtacctgggaattccgttcgatccgtcctgcgttcgcccacccctc
ttgaccgaggccgggttggcgcgcgccctagaggaggagcggctgccgctcgatcttcct
gaagacgacgccgccctcggcgcctttctccgtgcgaggctcggcgacgagtgggtgaac
tacgtcggcgagccgctcatggcaggcatctacgcgggcgacatcgaccaactgtcgctc
atggccacgtggcccttgctcctcgacctcatccgcaaccacggcagcctcgtggcggca
agccgggcgctcatggccccgtcgagcaggcgccagcctggctcgagccggagcgcgttc
atcaccgtgcgcggcgggctgtcgtccgtgatcgagcgcatggtggatcggatcgaacgg
agcggccgggtcgagatccgcatcggtgcgcgcgtcggcgcggtgacaaggcgcggcgcg
gcgtaccggttccatatcgatacggcctcaggtgagcgctttgaggaggacgtggacggc
gtggtgttcgccatcccgccgcaagtcgcccgcgagatcatgagctcggtgatcgacctt
cccgacgtggaaacgcactaccaatcgacggccaccatcgtactcgtgtacgcgcgcacc
gcgtttgggccggatctcgcgcgggcgtcgggcttcctcgtgccgcggcccgagggaatg
gccatcaccgcgacgacgtggatgtcgagcaagtggccgcacgttgcccccgagtccctc
gccgtgatccgcgcctacgtcggcagacgccaccaggacgaggcgctcgcgctgtccgac
gacgaactggcgcgtcgcgcggcggaagaggtcggacgcctcacgggcgcgcgcgaacac
cctgtatggcttcgggtgacgcgcttttcggaggcgatgccgaactacggcctgggacac
ctcgcccgcgtggagcgggcggaagcggcgcttcgcgcgtcctgtcccgcgatggctatc
gccggggctggctaccgcggcgtcggtctgcccgactgcgtggagcagggcgaacgggcg
gccgatcaggtcctcgccgccatccgcgcatga

DBGET integrated database retrieval system