KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2135Help
Entry
Aaci_2135         CDS       T00985                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aaci_2135
   01230 Biosynthesis of amino acids
    Aaci_2135
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aaci_2135
   00030 Pentose phosphate pathway
    Aaci_2135
   00051 Fructose and mannose metabolism
    Aaci_2135
   00052 Galactose metabolism
    Aaci_2135
  Energy metabolism
   00680 Methane metabolism
    Aaci_2135
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Aaci_2135
Enzymes [BR:aac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Aaci_2135
Protein phosphatases and associated proteins [BR:aac01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Aaci_2135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2192834..2193808)
Genome map
AA seq 324 aa AA seqDB search
MGVLAIQKIGVLTSGGDAPGMNAAIRAVVRTAIYHGLEVVGIRRGYAGLLDGDFRPMPIE
SVGDIIQRGGTCLFTARCKEFMTEEGQRRGYERLVEAGIEGLVVLGGDGSFRGAKRLSEL
GIPTVGVPCTIDNDIGACDANIGFDTAVQTVIQAIDKIRDTATSHERTYVIEVMGRHAGH
IALAAGLAGGAESVLIPEVPFNLEDVVAKLQRGVARGKKHSIIVVAEGAARAVDVGHYIE
EKTGFDTRVTVLGHVQRGGAPTASDRVLASRLGAFAVELLLKGETAVMAATQNGALVAVP
FDEVFAAVRQPAQELCELAEILSN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgggggtgttggccattcaaaagataggcgttttgacgagcgggggcgacgcgcctggc
atgaacgcggccatccgcgccgtggtccgcacggccatctaccacggcctggaggtcgtc
ggcattcgcagggggtacgcgggcttgttggacggggattttcgtccgatgcccatcgaa
tccgtcggcgacatcattcagcgcggcggaacctgcctgtttacggcgcgttgcaaggag
ttcatgaccgaagaggggcagaggcgcgggtatgagcggctcgtcgaggccgggattgag
ggtctcgtcgtgctcgggggagacggatcgtttcgaggcgccaagcgcctgagcgagctg
ggcattcccacggtcggagtgccttgcaccatcgacaacgacatcggcgcgtgcgacgca
aacatcggcttcgacacggcggtgcagacggtgattcaggccatcgataaaatccgcgac
acggccacgtcgcacgagcggacgtatgtcattgaggtcatgggtcggcacgccgggcat
atcgcgctggcggccgggctcgcgggcggcgcggagagcgtgctgatccctgaggtcccg
ttcaacctcgaggatgtggtggcgaagctgcagcgcggcgtggcccggggcaagaaacac
tccatcatcgtggtggcggaaggcgcggcgcgcgcggtggatgtcgggcactacatcgag
gagaagaccgggtttgacacgcgcgtgaccgtgctcgggcacgtccagcgcggtggcgcg
ccaacagcgtccgatcgcgtcctcgccagccgcttgggcgctttcgcagtcgaactcctc
ctcaaaggcgagaccgcggtcatggccgccacgcagaacggggcgctcgtggcggtgccg
tttgacgaggtgtttgcggccgtgcgccagcctgcgcaggaactttgcgagctggccgag
attctatccaactaa

DBGET integrated database retrieval system