KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2143Help
Entry
Aaci_2143         CDS       T00985                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00020  Citrate cycle (TCA cycle)
aac00310  Lysine degradation
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
aac01130  Biosynthesis of antibiotics
aac01200  Carbon metabolism
Module
aac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aaci_2143
  Amino acid metabolism
   00310 Lysine degradation
    Aaci_2143
Enzymes [BR:aac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Aaci_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 RnfC_N E3_binding GCV_H TFIIA
Motif
Other DBs
NCBI-ProteinID: ACV59152
UniProt: C8WQY3
Position
complement(2204718..2205971)
Genome map
AA seq 417 aa AA seqDB search
MAEVKVPSLGESIVEATIGQWLKREGDAVESGEAIAELETDKVNVEVIAEASGVLAQILK
QVGDTVAIGDVIAVIAEGQAPSAPASASAPAAQAQEVKPSAPSAPQAQAQAPSAPSAPQV
SAQQQVSVPGELLVRPTPSLRRAAAAQGIDLRQVQAGALGLGAQPAAPQAAPAPAVQPAS
QAALRPDEERIRMSRRRATIAKRLVEAQHTAAMLTTFNEVDMSRVIEIRKRRKDAFREKY
GVGLGYMSFFTKAVVGALKQFPLLNAEIQGEDMIVKHHYDIGIAVATEGGLVVPVVRNAD
RLTFAEIEQQIADLAARARANKLSLEELQGGTFTITNGGTFGSLFSTPILNAPQVGILGM
HNIVERPVAVNGQVEIRPMMYIALSYDHRIVDGAEAVSFLVTVKRLIEDPESLLLEG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaggtcaaggttccatcgctaggcgagtcgattgtggaagcgacgattgggcag
tggctcaagcgcgaaggggatgcggttgagtcgggcgaggccatcgcggagctggagacg
gacaaggtcaacgtggaggtcattgcggaggcgtcgggcgtcctggcgcagatcctcaag
caggtcggcgataccgtggcgattggggatgtcattgccgtgatcgcggagggccaggcg
ccgtctgcgcctgcctcggcgtcggctccggccgcgcaggcgcaggaggtcaagccgtcc
gcgccgagcgctccgcaggcgcaagcacaggcgccgtccgcgccatccgcgccgcaggtc
tcggcacagcagcaggtctcggtcccgggcgagcttttggtgcgcccgacgccgtctctg
cggcgggctgcggccgcgcagggcatcgatctccgtcaggtgcaggctggtgccttgggt
ctcggcgcccaaccggcggcgccccaggcagctcccgccccggcagttcagcctgcgtcc
caggcggcgcttcgcccggatgaggaacggatccgcatgtcgcgtcgccgcgcgaccatc
gcgaagcgcctcgtggaggctcagcacaccgcggccatgctcaccacgttcaatgaagtg
gacatgagccgggtgatcgagatccgcaagcggcgcaaggacgcgttccgcgagaagtac
ggcgtggggcttggctacatgtcgttcttcacgaaggcggtcgtgggtgcgctgaagcag
ttcccgctcctgaacgcggaaattcagggcgaggacatgattgtgaagcaccactacgac
atcggcatcgcggtggcgacggagggcggccttgtcgtgccggtggttcggaacgcggat
cgcctgacgtttgccgagatcgagcagcagattgccgatctcgccgcgcgcgctcgcgcg
aacaagctgtcgctcgaggaactgcagggtgggaccttcaccatcacgaacggaggcacg
ttcggctcgctgttctcgacgcccatcctgaacgcgccccaggtcggcatccttgggatg
cataacatcgtggagcgcccggtggcggtgaatgggcaggtggagatccgcccgatgatg
tatatcgcgctttcgtacgatcaccgcattgtggacggagcggaggccgtgagcttcctg
gtgaccgtgaagcggctgatcgaggatccggagtccctgttgctcgaaggctga

DBGET integrated database retrieval system