KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2180Help
Entry
Aaci_2180         CDS       T00985                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:aac00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aac00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2242895..2244220)
Genome map
AA seq 441 aa AA seqDB search
MDVATYFPEVTRIAYEGKRSDNPLSFKYYNPDEIVLGKPMKEHLRFSVAYWHTFTLSGAD
PFGLPNMIRPWDGATGMDLAKRRVEAAFEFMTKLGVEYFCFHDRDIAPEGDTLRETNRNL
DEIVALIKEYMQSTGIKLLWNTQNLFSNPRFAHGAATAPDADVFAYAAAQVKKSLEIAKE
LGAENYVFWGGREGYETLLNTDLKLELDNYARLLQMAVDYADEIGFTGQFLIEPKPKEPT
KHQYDFDVQSGLAFLYHYGLKDRFKFNIEANHATLAGHTFQHELRFARIHGLLGSVDANQ
GDPLLGWDTDEFPTNLYETTLAMYEILLNGGLAPGGLNFDAKVRRASMTPIDLFYGHIAG
MDSFARGLKVAAKLLEDRVFEREIEERYESYRTGIGKDIVEGRATLKSLESYVIDKRVTA
TRSGRQEVLLAKLNQYLLETE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggcgacgtactttcctgaagtgacgcgcattgcgtatgaaggcaagcgctcc
gacaatccgctctcgttcaagtattacaatccggacgagatcgtgttgggcaagccgatg
aaggaacatctccgcttctcggtggcctactggcacacgttcaccctgtccggcgctgat
ccgttcgggttgccgaacatgatccggccgtgggacggcgcgacggggatggatttggcc
aagcgccgcgtggaggccgcgttcgagttcatgacgaagctcggcgtcgagtacttctgt
ttccacgatcgcgacatcgcgcccgagggcgacacgctgcgggagaccaaccgcaatctg
gacgagatcgtcgccctgatcaaggaatacatgcagtcgacgggcatcaaacttctgtgg
aatacgcagaacctgttctcgaatccaaggtttgcccacggggccgcgacggcgccagac
gcggacgtgtttgcgtacgcggccgcgcaggtgaagaagagcctcgaaattgcgaaggag
ctcggggcggaaaactacgtcttctggggcggacgtgaaggctacgagacgctcctcaac
acggatctcaagcttgagctcgacaactatgcgcgcctcctgcagatggcggtggactac
gcggacgaaatcggcttcacggggcagttcttgattgagccgaagccgaaggagcccacg
aagcatcagtacgatttcgacgtgcagtcggggctcgcgttcctctatcattacgggctc
aaggaccgattcaaattcaacatcgaggcgaatcacgccacgctcgccggccacacgttc
cagcacgaacttcgcttcgcccggatccacggcctcctgggatctgtcgacgcgaaccag
ggcgatccgctgcttggctgggacacggacgagtttccgaccaacctgtacgagacgacg
ctcgcgatgtacgagattctcctgaatggcgggcttgcgccgggcggcctgaacttcgac
gccaaggtgcgccgcgcgtcgatgacacccatcgatctgttttacgggcacatcgccggg
atggacagcttcgcgcgcgggctcaaggtggcggctaagctgctcgaggaccgcgtgttc
gagcgggaaattgaggagcgatacgagagctatcggaccggcatcgggaaagacatcgtg
gaagggcgcgcgacgctaaaatccctcgagtcgtacgtgatcgacaagcgcgtgacggcg
acgcgatccggccgccaggaggtcctgctggcgaaattgaatcagtatctgctggagacg
gaatga

DBGET integrated database retrieval system