KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2394Help
Entry
Aaci_2394         CDS       T00985                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Aaci_2394
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aaci_2394
  Lipid metabolism
   00071 Fatty acid degradation
    Aaci_2394
  Amino acid metabolism
   00350 Tyrosine metabolism
    Aaci_2394
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Aaci_2394
   00626 Naphthalene degradation
    Aaci_2394
Enzymes [BR:aac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Aaci_2394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2455176..2456201)
Genome map
AA seq 341 aa AA seqDB search
MRALVFDPEGGLRVAEVPTPQPGPGEILVRVEACGICGSDRQLVRGEGAPLGTSYPVVLG
HEIAGRVAALGEGASGFAPGDAVVVHPFVPCGQCAACARGEEHLCPHQGVMGFTRPGGDA
EYVAVPAQNAIRRPDGLDPAEAAILVDAYATPYRAMVSVGVAEEEAVLVIGTGGLGLAAV
QIAKALGVPQVAVLSRREDAGALALVSGADEFVTLSDDPRQAARRLRRMAKGGVGLVLDT
SGFADGIAFALDVLRPGGKMVTVAMPSDEIPVPFAKLARKGMSIMGSFGSRRADVEELLR
MAAEGRVQPDVVAGRRVSLEEAPDAIKNPFFGRDVVVFGSP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgctcgtgtttgacccggaaggcggcctacgcgtcgcggaggtgccaacgcca
cagcctgggcctggcgagatcctcgtccgcgtcgaggcgtgcggcatctgcggcagcgac
cggcaactggtccgcggcgagggcgcgccgttggggacgtcgtatccggtggtgttgggc
cacgagatcgcgggccgcgtggcggcgctcggcgagggcgcctcgggcttcgcgccgggc
gacgcggtggtcgtgcacccgtttgtgccgtgcggccagtgcgcggcgtgcgcgcggggc
gaggagcatctgtgcccgcaccagggcgtgatgggcttcacgcggccgggcggcgacgcg
gagtacgtagcggttccggcgcaaaacgccattcgccgcccggacgggctcgatccggcc
gaggcggccatcctggtcgacgcgtacgcgacgccgtaccgggccatggtgtcggtcggc
gtggccgaggaggaggcggtgctcgtcatcggcacgggcgggctggggctcgcggcggtg
caaatcgccaaggccctgggcgtgcctcaggtggccgtgttgagccggcgagaggacgcg
ggcgcgctcgctcttgtctccggcgcggacgaattcgtgacgctctcggacgatccgcgc
caggccgcgcgcaggctgcggcgcatggcgaaaggcggggtgggcctcgtgctcgacacg
tccgggtttgcggacgggatcgccttcgccctggacgtcctgcgcccaggcggcaagatg
gtgaccgtggcgatgccctcggacgagatccccgtgccgttcgcgaagctcgcgcgcaaa
ggcatgtcgatcatggggagctttggctcgcgccgcgcggacgtcgaagagctcctccgg
atggcggcggaggggcgcgttcagccggacgtcgtggcggggcggcgggtgtcgctcgag
gaggccccggacgcgataaagaacccgtttttcggccgagatgtcgtcgtgttcggatcg
ccgtga

DBGET integrated database retrieval system