KEGG   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446: Aaci_2422Help
Entry
Aaci_2422         CDS       T00985                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
aac  Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
Pathway
aac00860  Porphyrin and chlorophyll metabolism
aac01100  Metabolic pathways
aac01110  Biosynthesis of secondary metabolites
aac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Aaci_2422
Enzymes [BR:aac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Aaci_2422
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Aaci_2422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: ACV59429
UniProt: C8WSE4
Position
complement(2483346..2484776)
Genome map
AA seq 476 aa AA seqDB search
MAYGRVALVGAGPGHPGLLTERARALVEQADVVVFDRLVSPRLLMHAKPDAALLYAGKAP
GCHALAQRDIEAMLVDLARHHGLVVRLKGGDPLVFGRGAEEASALREAGVPFELVPGVTS
AVAVPAFAGIPVTLRGVSRSFAVATGHAGDGLRAHLDALAGAETLVLLMGVAELPRIAAE
LIARGISADTPAAIVAWGSRAKQRSLRATLATLAAEAERRGIGSPAVIVIGDVAADASLG
SWFESMPRFGERHLLFASSMREALAHAAQLEAEGAEVLAHTWDRARSLRTADVDAAVSMS
AHGKPVGFAFRTALGVETWLCAVQRAGLDLRRLSNLKLAAVDGYVAQALRDRGLAPDARS
LGEMARMPVEVWFAEAPGSGRDADVEAACRASGAEVRPLHLLGPRFVPAVSAPWQPFVRA
WRDIVAEWLADGPADLWALGDPALLRPLAVDVGMGGEPLRRADAFGLAAAEAVCGA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcatatggccgcgtggcgctcgtcggcgccggccctggccacccggggcttttgacc
gagcgcgcccgagcgctcgtcgaacaggcggatgtggtggtctttgacaggttggtctcg
ccgcgcctgctcatgcacgcgaaaccggacgccgcgcttttgtacgccggcaaggcgccg
ggctgccacgcgctcgcgcagcgggacattgaggcgatgctcgtcgatttggcgcgccat
cacggcctcgtcgtccgcctcaaggggggcgatccgctcgtgtttggccgcggcgcggag
gaagcgtccgccctgcgcgaggcgggcgtgccgttcgagctggtgccaggcgtcacgtcg
gccgtcgccgtgcccgcgtttgcgggcattccagtgaccttgcgcggcgtgagccgctcg
ttcgccgtggcaaccgggcacgcgggcgacggtctccgggcgcacctcgacgccctcgcg
ggggccgagacgctggtcctgctcatgggcgtcgccgaactgccgcgcattgcagcggag
ctcatcgcccggggcatctccgccgacacgccggccgccatcgtggcgtggggctcgcgc
gccaagcagcggtccctgcgcgcgacgcttgccacgctggccgccgaggcggagcggcgg
ggcatcggatcgcccgccgtgatcgtcatcggcgacgtggcggcggatgcgtcgctcggc
tcgtggttcgaatccatgccgcgcttcggcgaacgccacctcctctttgcgtcgtccatg
cgcgaggcgctcgcgcacgcggcgcagcttgaggccgagggggcggaggtgctcgcccac
acgtgggatcgagcgcggagtttgcgaacggctgacgtggacgctgcggtgtccatgtcg
gcgcacggcaagccggtgggcttcgccttccgcacggcgctcggcgttgagacgtggctc
tgcgccgtgcagcgcgccggattggatctgcgccggctctcgaatctcaagctcgccgcc
gtcgacggctacgtcgcgcaggccctgcgcgatcgcggccttgcgcccgacgcccgctcg
ctcggcgagatggcgcggatgcccgtggaggtgtggttcgccgaggcgcccggctcgggc
cgcgacgcggacgtggaggcggcctgcagggcgagcggcgccgaggtgcggccgcttcat
ctcctgggcccgcggttcgtgccggccgtgtccgcgccctggcagccgttcgtgcgggcg
tggcgcgacatcgtcgccgagtggctcgccgacggcccggccgacctgtgggcgctcggc
gatcccgccctgttgcggccgctcgccgtcgacgtggggatgggcggcgagccgctgcgc
cgcgccgacgcgttcgggctcgcggccgccgaggcggtgtgcggcgcatga

DBGET integrated database retrieval system